HPA009433
Anti-CANX antibody produced in rabbit
Ab1, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonim(y):
Anti-Calnexin precursor antibody produced in rabbit, Anti-IP90 antibody produced in rabbit, Anti-Major histocompatibility complex class I antigen-binding protein p88 antibody produced in rabbit, Anti-p90 antibody produced in rabbit
Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
About This Item
Polecane produkty
pochodzenie biologiczne
rabbit
Poziom jakości
białko sprzężone
unconjugated
forma przeciwciała
affinity isolated antibody
rodzaj przeciwciała
primary antibodies
klon
polyclonal
linia produktu
Prestige Antibodies® Powered by Atlas Antibodies
Postać
buffered aqueous glycerol solution
reaktywność gatunkowa
human
rozszerzona walidacja
independent
Learn more about Antibody Enhanced Validation
metody
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000
sekwencja immunogenna
DVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTYKAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEI
numer dostępu UniProt
Warunki transportu
wet ice
temp. przechowywania
−20°C
docelowa modyfikacja potranslacyjna
unmodified
informacje o genach
human ... CANX(821)
Szukasz podobnych produktów? Odwiedź Przewodnik dotyczący porównywania produktów
Opis ogólny
CANX (calnexin) is an endoplasmic reticulum (ER) chaperone, which is a homolog of calreticulin (Crt). It is an ER-membrane protein with a molecular weight of 67kDa. Its N and P domains face the ER lumen and its C-terminal faces the cytoplasmic region. It is a type I transmembrane protein. Cleavage of this protein results in separation of membrane and cytosolic regions, giving rise to a soluble form found in placenta.
Immunogen
Calnexin precursor recombinant protein epitope signature tag (PrEST)
Zastosowanie
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Działania biochem./fizjol.
CANX (calnexin) is a chaperone protein, which controls protein folding and quality control. It is specific to proteins composed of monoglucosylated oligosaccharides. It is also responsible for the assembly of viral proteins. The expression of this protein reduces with age, for instance oxidative stress-induced expression in human diploid fibroblasts (HDF) in older population. Thus, it might be involved in conferring protection to cells in various age-related disorders. CANX is responsible for glycan-independent interaction and retention of mutated Gas3/PMP22 (growth arrest-specific protein 3/peripheral myelin protein 22) proteins involved in Charcot-Marie-Tooth 1A and Dejerine Sottas syndrome.
Cechy i korzyści
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Powiązanie
Corresponding Antigen APREST71909
Postać fizyczna
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Informacje prawne
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Oświadczenie o zrzeczeniu się odpowiedzialności
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.
Nie możesz znaleźć właściwego produktu?
Wypróbuj nasz Narzędzie selektora produktów.
Kod klasy składowania
10 - Combustible liquids
Klasa zagrożenia wodnego (WGK)
WGK 1
Środki ochrony indywidualnej
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Certyfikaty analizy (CoA)
Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.
Masz już ten produkt?
Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.
Johan Nordholm et al.
The Journal of cell biology, 216(8), 2283-2293 (2017-07-12)
A primary function of 5' regions in many secretory protein mRNAs is to encode an endoplasmic reticulum (ER) targeting sequence. In this study, we show how the regions coding for the ER-targeting sequences of the influenza glycoproteins NA and HA
Helen Coe et al.
Molecular and cellular biochemistry, 359(1-2), 271-281 (2011-08-16)
Calnexin is an endoplasmic reticulum protein that has a role in folding newly synthesized glycoproteins. In this study, we used site-specific mutagenesis to disrupt cysteine and histidine amino acid residues in the N- and P-domains of calnexin and determined whether
Bok-Hee Choi et al.
Experimental & molecular medicine, 36(5), 499-503 (2004-11-24)
Aging is accompanied by the changes in the cells that decrease their capacity to respond to various forms of stress. Cells are known to respond to stresses through expression of stress-response proteins, heat-shock proteins composed of molecular chaperones. Recent studies
Vilasack Thammavongsa et al.
The Journal of biological chemistry, 280(39), 33497-33505 (2005-08-03)
Calnexin is an endoplasmic reticulum chaperone that binds to substrates containing monoglucosylated oligosaccharides. Whether calnexin can also directly recognize polypeptide components of substrates is controversial. We found that calnexin displayed significant conformational lability for a chaperone and that heat treatment
Alessandra Fontanini et al.
The Journal of biological chemistry, 280(3), 2378-2387 (2004-11-13)
Missense point mutations in Gas3/PMP22 are responsible for the peripheral neuropathies Charcot-Marie-Tooth 1A and Dejerine Sottas syndrome. These mutations induce protein misfolding with the consequent accumulation of the proteins in the endoplasmic reticulum and the formation of aggresomes. During folding
Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.
Skontaktuj się z zespołem ds. pomocy technicznej