Przejdź do zawartości
Merck

HPA008445

Sigma-Aldrich

Anti-YWHAE antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonim(y):

Anti-14-3-3 protein epsilon, Anti-14-3-3E

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
Numer w atlasie ludzkich białek:
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

linia produktu

Prestige Antibodies® Powered by Atlas Antibodies

Postać

buffered aqueous glycerol solution

reaktywność gatunkowa

mouse, human, rat

metody

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:500-1:1000

sekwencja immunogenna

MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKE

numer dostępu UniProt

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... YWHAE(7531)

Opis ogólny

Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein-ε (YWHAE) is one of the adaptor proteins that interacts with phosphorylated serine or threonine residue of target proteins. The gene encoding this protein is present on chromosome 17p13.

Immunogen

14-3-3 protein epsilon recombinant protein epitope signature tag (PrEST)

Zastosowanie

Anti-YWHAE antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige. Anti-YWHAE antibody produced in rabbit can also be used for immunoprecipitation.

Działania biochem./fizjol.

Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein-ε (YWHAE) binds to cyclin-dependent kinase 5 (CDK5)-phosphorylated nudE neurodevelopment protein 1-like 1 (NUDEL) and maintains its phosphorylation state. NUDEL is a cytoplasmic regulator of neuronal migration. YWHAE is required for neuronal development as it aids in the transport of the NUDEL complex. It has protective and preventive effect on schizophrenia.

Cechy i korzyści

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST71114

Postać fizyczna

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informacje prawne

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 1

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Środki ochrony indywidualnej

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Assignment of the human 14-3-3 epsilon isoform (YWHAE) to human chromosome 17p13 by in situ hybridization.
S C Luk et al.
Cytogenetics and cell genetics, 78(2), 105-106 (1997-01-01)
Masashi Ikeda et al.
Human molecular genetics, 17(20), 3212-3222 (2008-07-29)
Schizophrenia is a complex mental disorder with a fairly high degree of heritability. Although the causes of schizophrenia remain unclear, it is now widely accepted that it is a neurodevelopmental and neurodegenerative disorder involving disconnectivity and disorder of the synapses.
Cheng-Han Lee et al.
Proceedings of the National Academy of Sciences of the United States of America, 109(3), 929-934 (2012-01-10)
14-3-3 proteins are ubiquitously expressed regulators of various cellular functions, including proliferation, metabolism, and differentiation, and altered 14-3-3 expression is associated with development and progression of cancer. We report a transforming 14-3-3 oncoprotein, which we identified through conventional cytogenetics and
Wen-Bin Ou et al.
Oncogenesis, 10(5), 37-37 (2021-05-06)
Endometrial stromal sarcoma (ESS) is the second most common subtype of uterine mesenchymal cancer, after leiomyosarcoma, and oncogenic fusion proteins are found in many ESS. Our previous studies demonstrated transforming properties and diagnostic relevance of the fusion oncoprotein YWHAE-NUTM2 in

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej