HPA007354

Anti-MFAP2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonim(y): Anti-MAGP antibody produced in rabbit, Anti-MAGP-1 antibody produced in rabbit, Anti-MFAP-2 antibody produced in rabbit, Anti-Microfibril-associated glycoprotein antibody produced in rabbit, Anti-Microfibrillar-associated protein 2 precursor antibody produced in rabbit
• Kod UNSPSC: 12352203
• Numer w atlasie ludzkich białek: HPA007354
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• linia produktu: Prestige Antibodies^® Powered by Atlas Antibodies
• Formularz: buffered aqueous glycerol solution
• reaktywność gatunkowa: human
• rozszerzona walidacja: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• metody: immunohistochemistry: 1:200- 1:500
• sekwencja immunogenna: QYTHYSDQIDNPDYYDYQEVTPRPSEEQFQFQSQQQVQQEVIPAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRTVCAHEELLRADLCRDKFSKCG
• numer dostępu UniProt: P55001
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... MFAP2(4237)

Opis

Opis ogólny

MFAP2 (microfibrillar-associated protein 2) protein is found to be expressed in the stroma and extracellular matrix of blood vessels, lung, muscle, skin and among other tissues. The gene is localized to human chromosome 1p36.1-p35.

Immunogen

Microfibrillar-associated protein 2 precursor recombinant protein epitope signature tag (PrEST)

Zastosowanie

Anti-MFAP2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Działania biochem./fizjol.

MFAP2 (microfibrillar-associated protein 2) gene encodes a secreted protein that forms a component of the elastin-associated microfibrils. It is involved in cell-associated and matrix-associated functions. It is capable of binding to fibrillin-1 and fibrillin-2 that are part of the extracellular microfibrils. It functions in the binding and activation of αvβ3 integrins and modulates Notch signaling. Overexpression of this protein has been associated with poor prognosis in a study of human papillary serous ovarian carcinomas. It is found to promote the progression of ovarian cancer through its pro-angiogenic activity.

Cechy i korzyści

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST86580

Postać fizyczna

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informacje prawne

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable
• Środki ochrony indywidualnej: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)