Wszystkie zdjęcia(7)
Kluczowe dokumenty
HPA006564
Anti-PRKCA antibody produced in rabbit
Ab2, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonim(y):
Anty-PKCA
Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
About This Item
Polecane produkty
pochodzenie biologiczne
rabbit
Poziom jakości
białko sprzężone
unconjugated
forma przeciwciała
affinity isolated antibody
rodzaj przeciwciała
primary antibodies
klon
polyclonal
linia produktu
Prestige Antibodies® Powered by Atlas Antibodies
Formularz
buffered aqueous glycerol solution
reaktywność gatunkowa
rat, mouse, human
rozszerzona walidacja
independent
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
metody
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
sekwencja immunogenna
RTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNMELRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVV
numer dostępu UniProt
Warunki transportu
wet ice
temp. przechowywania
−20°C
docelowa modyfikacja potranslacyjna
unmodified
informacje o genach
human ... PRKCA(5578)
Szukasz podobnych produktów? Odwiedź Przewodnik dotyczący porównywania produktów
Powiązane kategorie
Opis ogólny
PRKCA (kinaza białkowa C, α) jest wielodomenowym białkiem sygnalizacyjnym. Ulega ekspresji głównie w cytozolu i jądrach komórkowych. Jest to zależna od Ca2+ i fosfolipidów białkowa kinaza serynowo-treoninowa. Jest aktywowana przez diacyloglicerol.
Immunogen
Protein kinase Cα-type recombinant protein epitope signature tag (PrEST)
Zastosowanie
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Działania biochem./fizjol.
PRKCA (kinaza białkowa C, α) jest zaangażowana w N-końcową fosforylację β-kateniny. PKCα fosforyluje β-kateninę poprzez bezpośrednie oddziaływanie w pozycjach reszt Ser-Thr. Zasadniczo występuje w fosforylacji Bcl2 (chłoniak B-komórkowy 2), a także w hamowaniu apoptozy. Podczas obrony gospodarza i stanu zapalnego działa w indukowanych przez LPS (lipopolisacharyd) funkcjach makrofagów, kontrolując ekspresję czynnika martwicy nowotworów TNF-α, wydzielanie interleukiny IL-1 i aktywność przeciwnowotworową.
Cechy i korzyści
4357 to wysoce scharakteryzowane i wszechstronnie zwalidowane przeciwciała z dodatkową korzyścią w postaci wszystkich dostępnych danych dotyczących charakterystyki każdego celu, które są dostępne za pośrednictwem portalu Human Protein Atlas, do którego link znajduje się tuż pod nazwą produktu na górze tej strony. Wyjątkowość i niska reaktywność krzyżowa przeciwciał 4357 z innymi białkami wynika z dokładnego doboru regionów antygenowych, oczyszczania metodą powinowactwa i rygorystycznej selekcji. Kontrole antygenów Prestige są dostępne dla każdego odpowiedniego przeciwciała Prestige i można je znaleźć w sekcji powiązań.
Każde przeciwciało Prestige jest testowane w następujący sposób:
Każde przeciwciało Prestige jest testowane w następujący sposób:
- Macierz tkankowa IHC 44 normalnych tkanek ludzkich i 20 najczęściej występujących tkanek nowotworowych.
- Macierz białkowa 364 ludzkich rekombinowanych fragmentów białkowych.
Powiązanie
Odpowiadający antygen APREST70021
Postać fizyczna
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Informacje prawne
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Oświadczenie o zrzeczeniu się odpowiedzialności
O ile nie określono inaczej w naszym katalogu lub innej dokumentacji firmy dołączonej do produktu(-ów), nasze produkty są przeznaczone wyłącznie do użytku badawczego i nie mogą być wykorzystywane do żadnych innych celów, w tym między innymi do nieautoryzowanych zastosowań komercyjnych, zastosowań diagnostycznych in vitro, zastosowań terapeutycznych ex vivo lub in vivo lub jakiegokolwiek rodzaju konsumpcji lub zastosowania u ludzi lub zwierząt.
Ta strona może zawierać tekst przetłumaczony maszynowo.
Nie możesz znaleźć właściwego produktu?
Wypróbuj nasz Narzędzie selektora produktów.
polecane
Kod klasy składowania
10 - Combustible liquids
Klasa zagrożenia wodnego (WGK)
WGK 1
Temperatura zapłonu (°F)
Not applicable
Temperatura zapłonu (°C)
Not applicable
Środki ochrony indywidualnej
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Wybierz jedną z najnowszych wersji:
Certyfikaty analizy (CoA)
Lot/Batch Number
Nie widzisz odpowiedniej wersji?
Jeśli potrzebujesz konkretnej wersji, możesz wyszukać konkretny certyfikat według numeru partii lub serii.
Masz już ten produkt?
Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.
Lenka Dzurová et al.
Photodiagnosis and photodynamic therapy, 11(2), 213-226 (2014-03-04)
Hypericin photodynamic therapy (HypPDT) has been found to be an efficient inducer of cell death. However, there are indications that HypPDT also activates rescuing pathways. Cell responses to HypPDT are highly dependent on the Hyp intracellular localization and accumulation. We
Jungsug Gwak et al.
Biochemical and biophysical research communications, 450(4), 1673-1678 (2014-07-25)
Protein kinase Cα (PKCα) phosphorylates the Ser33/37/Thr41 residues of β-catenin, which lacks a typical PKCα canonical sequence, but little is known about its underlying mechanism. Here we showed that Ser33/Ser37/Thr41 of β-catenin fragments encompassing the armadillo repeats 1-5 (β-catenin1-781, β-catenin1-682
Carter J Swanson et al.
The Journal of biological chemistry, 289(25), 17812-17829 (2014-05-03)
Signaling proteins comprised of modular domains have evolved along with multicellularity as a method to facilitate increasing intracellular bandwidth. The effects of intramolecular interactions between modular domains within the context of native proteins have been largely unexplored. Here we examine
A St-Denis et al.
The Journal of biological chemistry, 273(49), 32787-32792 (1998-11-26)
Lipopolysaccharide (LPS), a potent modulator of macrophage functional activity, binds to CD14 and triggers the activation of several protein kinases, leading to the secretion of variety of immunomodulatory molecules such as nitric oxide and proinflammatory cytokines. In this study, we
P P Ruvolo et al.
The Journal of biological chemistry, 273(39), 25436-25442 (1998-09-17)
Phosphorylation of Bcl2 at serine 70 may result from activation of a classic protein kinase C (PKC) isoform and is required for functional suppression of apoptosis by Bcl2 in murine growth factor-dependent cell lines (Ito, T., Deng, X., Carr, B.
Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.
Skontaktuj się z zespołem ds. pomocy technicznej