HPA005131

Anti-REN antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonim(y): Anti-Angiotensinogenase antibody produced in rabbit, Anti-Renin precursor antibody produced in rabbit
• Kod UNSPSC: 12352203
• Numer w atlasie ludzkich białek: HPA005131
• NACRES: NA.41
• białko sprzężone: unconjugated
• application: IHC
• klon: polyclonal
• reaktywność gatunkowa: human
• citations: 6
• metody: immunohistochemistry: 1:50- 1:200

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• linia produktu: Prestige Antibodies^® Powered by Atlas Antibodies
• Formularz: buffered aqueous glycerol solution
• reaktywność gatunkowa: human
• metody: immunohistochemistry: 1:50- 1:200
• sekwencja immunogenna: FHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFD
• numer dostępu UniProt: P00797
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... REN(5972)

Opis

Opis ogólny

REN gene encodes the enzyme renin, which is expressed mainly by the granular cells of the kidney in the juxtaglomerular apparatus. REN gene is 12.5kb in length and is localised to the chromosomal region 1q32. Renin is a protease enzyme, which cleaves at the aspartate residue and is synthesised as prorenin. Prorenin includes an additional 43 amino acid fragment at the N-terminal. Renin has a molecular weight of 37kDa and is composed of 340 amino acids. There is evidence that renin is also expressed in ovary, testis, submandibular gland, adrenal gland, brain, heart etc.

Immunogen

Renin precursor recombinant protein epitope signature tag (PrEST)

Zastosowanie

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Działania biochem./fizjol.

Renin is a key enzyme in the renin-angiotensin system (RAS), which is responsible for maintaining blood pressure and salt homeostasis. Renin converts the inactive angiotensinogen to angiotensin I and this step is the rate limiting step in RAS. Angiotensin I is then converted into angiotensin II, which, through a series of steps, leads to an increase in blood pressure and sodium retention by kidneys. Mutations, which lead to the deletion of leucine or exchange of leucine in the signal peptide of prorenin, are found to be associated with early onset anemia, hypouricosuric hyperuricemia and progressive kidney failure. Renin rs6693954 polymorphism has been linked with blood pressure in type II diabetes patients, in a gender-dependent manner.

Cechy i korzyści

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST85921

Postać fizyczna

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informacje prawne

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable
• Środki ochrony indywidualnej: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)