AV54575
Anti-GFRA2 antibody produced in rabbit
affinity isolated antibody
Synonim(y):
Anti-GDNF family receptor α2, Anti-GDNFRB, Anti-NRTNR-ALPHA, Anti-NTNRA, Anti-RETL2, Anti-TRNR2
Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
About This Item
Kod UNSPSC:
12352203
NACRES:
NA.41
klon:
polyclonal
application:
WB
reaktywność gatunkowa:
horse, dog, mouse, rat, human, pig, rabbit
metody:
western blot: suitable
citations:
5
pochodzenie biologiczne
rabbit
Poziom jakości
białko sprzężone
unconjugated
forma przeciwciała
affinity isolated antibody
rodzaj przeciwciała
primary antibodies
klon
polyclonal
Formularz
buffered aqueous solution
masa cząsteczkowa
47 kDa
reaktywność gatunkowa
horse, dog, mouse, rat, human, pig, rabbit
stężenie
0.5 mg - 1 mg/mL
metody
western blot: suitable
numer dostępu NCBI
numer dostępu UniProt
Warunki transportu
wet ice
temp. przechowywania
−20°C
informacje o genach
human ... GFRA2(2675)
Immunogen
Synthetic peptide directed towards the C terminal region of human GFRA2
Zastosowanie
Anti-GFRA2 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Działania biochem./fizjol.
GFRA2 are cell surface bound glycoproteins that mediate interactions of the glial-cell-line-derived neurotrophic factor (GDNF) ligand family with the RET receptor that are crucial for the development of kidney and some peripheral nerve lineages. GFRA2 gene is shown to be associated with tardive dyskinesia in a study. The factors GDNF and neurturin, along with their receptors GFRA1 and GFRA2, respectively, are crucial for enteric neuron survival in human colon. The gene is shown to be associated with schizophrenia and clozapine response in a study. It is associated with severe abdominal pain sensation in pancreatic cancer patients.
Sekwencja
Synthetic peptide located within the following region: NVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLK
Postać fizyczna
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Oświadczenie o zrzeczeniu się odpowiedzialności
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.
Nie możesz znaleźć właściwego produktu?
Wypróbuj nasz Narzędzie selektora produktów.
Kod klasy składowania
10 - Combustible liquids
Klasa zagrożenia wodnego (WGK)
WGK 3
Temperatura zapłonu (°F)
Not applicable
Temperatura zapłonu (°C)
Not applicable
Wybierz jedną z najnowszych wersji:
Certyfikaty analizy (CoA)
Lot/Batch Number
Nie widzisz odpowiedniej wersji?
Jeśli potrzebujesz konkretnej wersji, możesz wyszukać konkretny certyfikat według numeru partii lub serii.
Masz już ten produkt?
Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.
M Barrenschee et al.
Cell and tissue research, 354(2), 371-380 (2013-07-25)
Two of the glial-cell-line-derived neurotrophic factor (GDNF) family ligands (GFLs), namely GDNF and neurturin (NRTN), are essential neurotropic factors for enteric nerve cells. Signal transduction is mediated by a receptor complex composed of GDNF family receptor alpha 1 (GFRα1) for
J B Vanhorne et al.
Human genetics, 108(5), 409-415 (2001-06-21)
The glial-cell-line-derived neurotrophic factor (GDNF) family receptors alpha (GFRalpha) are cell surface bound glycoproteins that mediate interactions of the GDNF ligand family with the RET receptor. These interactions are crucial to the development of the kidney and some peripheral nerve
Renan P Souza et al.
Journal of psychiatric research, 44(11), 700-706 (2010-02-02)
GDNF (glial-cell-line derived neurotrophic factor) is a potent neurotrophic factor for dopaminergic neurons. Neuropsychiatric diseases and their treatments are associated with alterations in the levels of both GDNF and its receptor family (GDNF family receptor alpha or GFRA). GFRA1, GFRA2
Renan P Souza et al.
Psychopharmacology, 210(3), 347-354 (2010-04-07)
Tardive dyskinesia (TD) has a pharmacogenetic component in which the interaction of antipsychotic exposure with individual genetic variation mediates risk. The glial cell line-derived neurotrophic factor (GDNF) signalling pathway has been associated with neuroprotective effects in central dopaminergic neurons and
Kun Wang et al.
Carcinogenesis, 35(1), 103-113 (2013-09-27)
Neurotrophic factors possess an emerging role in the pathophysiology of several gastrointestinal disorders, regulating innervation, pain sensation and disease-associated neuroplasticity. Here, we aimed at characterizing the role of the neurotrophic factor neurturin (NRTN) and its receptor glial-cell-line-derived neurotrophic factor receptor
Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.
Skontaktuj się z zespołem ds. pomocy technicznej