Przejdź do zawartości
Merck
Wszystkie zdjęcia(1)

Key Documents

AV51676

Sigma-Aldrich

Anti-NUFIP2 antibody produced in rabbit

affinity isolated antibody

Synonim(y):

Anti-182-FIP, Anti-82-FIP, Anti-FIP-82, Anti-FLJ10976, Anti-KIAA1321, Anti-MGC117262, Anti-Nuclear fragile X mental retardation protein interacting protein 2, Anti-PIG1

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

76 kDa

reaktywność gatunkowa

human, dog, rat, bovine, mouse, horse, guinea pig, rabbit

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

numer dostępu UniProt

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... NUFIP2(57532)

Immunogen

Synthetic peptide directed towards the N terminal region of human NUFIP2

Zastosowanie

Anti-NUFIP2 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.

Działania biochem./fizjol.

Nuclear fragile X mental retardation protein interacting protein 2 (NUFIP2) is an RNA-binding protein involved in posttranslational regulation. It is found in association with actively translating polyribosomes, RNA granules in cytoplasm, RNA complexes in neurites and RNAi machinery.

Sekwencja

Synthetic peptide located within the following region: IPNGVVTNNSGYITNGYMGKGADNDGSGSESGYTTPKKRKARRNSAKGCE

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Andres Ramos et al.
Structure (London, England : 1993), 14(1), 21-31 (2006-01-13)
FMRP, whose lack of expression causes the X-linked fragile X syndrome, is a modular RNA binding protein thought to be involved in posttranslational regulation. We have solved the structure in solution of the N-terminal domain of FMRP (NDF), a functionally
Barbara Bardoni et al.
Human molecular genetics, 12(14), 1689-1698 (2003-07-03)
FMRP is an RNA binding protein whose absence produces pathological manifestations of the fragile-X syndrome. FMRP is a component of mRNP complexes found in association with actively translating polyribosomes, RNA complexes trafficking in neurites, RNA granules in cytoplasm and, in

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej