Przejdź do zawartości
Merck
Wszystkie zdjęcia(1)

Key Documents

AV51270

Sigma-Aldrich

Anti-TNNI2 antibody produced in rabbit

IgG fraction of antiserum

Synonim(y):

Anti-AMCD2B, Anti-DA2B, Anti-FSSV, Anti-Troponin I type 2 (skeletal, fast)

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(1)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

100

białko sprzężone

unconjugated

forma przeciwciała

IgG fraction of antiserum

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

21 kDa

reaktywność gatunkowa

bovine, dog, horse, guinea pig, human, rat, rabbit, goat

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

NP_003273

numer dostępu UniProt

P48788

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... TNNI2(7136)

Immunogen

Synthetic peptide directed towards the N terminal region of human TNNI2

Zastosowanie

Anti-TNNI2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml.

Działania biochem./fizjol.

Troponin I type 2 (TNNI2) is a fast-twitch muscle protein belonging to the troponin I gene family. It forms a complex that regulates striated muscle contraction along with troponins T and C. TNNI2 also has a role in smooth muscle contraction, angiogenesis, metastasis and tumor growth. Mutations in TNNI2 gene have been implicated in myopathy1 and distal arthrogryposis type 2B.

Sekwencja

Synthetic peptide located within the following region: PLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKL

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

E Kimber et al.
Neurology, 67(4), 597-601 (2006-08-23)
To describe a three-generation family with distal arthrogryposis associated with myopathy and caused by a mutation in the gene encoding for sarcomeric thin filament protein troponin I, TNNI2. The authors performed clinical investigations and reviewed medical records. Muscle biopsy specimens
Miao Jiang et al.
Human genetics, 120(2), 238-242 (2006-06-28)
Distal arthrogryposis (DA) is composed of a group of clinically and genetically heterogeneous disorders, characterized by multiple congenital contractures of the limbs. Point mutations in three genes encoding contractile fast-twitch myofibers, TPM2, TNNI2 and TNNT3, were recently identified in DA
GuangWu Xiong et al.
Science in China. Series C, Life sciences, 50(1), 93-100 (2007-03-30)
To explore the efficiency and mechanism of ovarian carcinoma gene therapy with the human fast-twitch skeletal muscle troponin I gene (Tnl-fast), Tnl-fast cDNA was transferred into human ovarian adenocarcinoma cell-line SK-OV-3. In vitro, the cell growth and cell cycle of

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej