AV50555

Anti-CASP8AP2 antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-CASP8 associated protein 2, Anti-CED-4, Anti-FLASH, Anti-FLJ11208, Anti-KIAA1315, Anti-RIP25
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Formularz: buffered aqueous solution
• masa cząsteczkowa: 223 kDa
• reaktywność gatunkowa: human, rat, mouse
• stężenie: 0.5 mg - 1 mg/mL
• metody: western blot: suitable
• numer dostępu NCBI: NP_001131140
• numer dostępu UniProt: Q9UKL3
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... CASP8AP2(9994)

Opis

Opis ogólny

CASP8AP2 codes for caspase 8 associated protein 2 and it may be implicated in apoptosis. This gene has been studied as a prognostic biomarker in pediatric acute lymphoblastic leukemia.
Rabbit Anti-CASP8AP2 antibody recognizes canine, bovine, human, mouse, and rat CASSP8AP2.

Immunogen

Synthetic peptide directed towards the N terminal region of human CASP8AP2

Zastosowanie

Rabbit Anti-CASP8AP2 antibody is suitable for western blot applications at a concentration of 1μg/ml.

Działania biochem./fizjol.

CASP8AP2 is highly similar to FLASH, a mouse apoptotic protein identified by its interaction with the death-effector domain (DED) of caspase 8. Studies of FLASH protein suggested that this protein may be a component of the death-inducing signaling complex that includes Fas receptor, Fas-binding adapter FADD, and caspase 8, and plays a regulatory role in Fas-mediated apoptosis.This protein is highly similar to FLASH, a mouse apoptotic protein identified by its interaction with the death-effector domain (DED) of caspase 8. Studies of FLASH protein suggested that this protein may be a component of the death-inducing signaling complex that includes Fas receptor, Fas-binding adapter FADD, and caspase 8, and plays a regulatory role in Fas-mediated apoptosis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Sekwencja

Synthetic peptide located within the following region: SLKKNISALIKTARVEINRKDEEISNLHQRLSEFPHFRNNHKTARTFDTV

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable