Przejdź do zawartości
Merck
Wszystkie zdjęcia(1)

Kluczowe dokumenty

AV48996

Sigma-Aldrich

Anti-GPT2 antibody produced in rabbit

affinity isolated antibody

Synonim(y):

Anti-ALT2, Anti-Glutamic pyruvate transaminase (alanine aminotransferase) 2

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(1)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

100

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

58 kDa

reaktywność gatunkowa

human, rat, rabbit, dog, bovine, horse, mouse, guinea pig

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

NP_597700

numer dostępu UniProt

Q8TD30

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... GPT2(84706)

Powiązane kategorie

Immunogen

Synthetic peptide directed towards the C terminal region of human GPT2

Zastosowanie

Anti-GPT2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Działania biochem./fizjol.

Glutamic pyruvate transaminase (alanine aminotransferase) 2 (GPT2; ALT2) is an enzyme that participates in the reversible transamination reaction that yields glutamate and pyruvate during gluconeogenesis.

Sekwencja

Synthetic peptide located within the following region: PEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVR

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Björn Glinghammar et al.
International journal of molecular medicine, 23(5), 621-631 (2009-04-11)
Serum alanine aminotransferase (ALT) is used as a clinical marker of hepatotoxicity. Three forms of human ALT have been identified, ALT1 and 2 and an alternative splice variant of ALT2 (herein called ALT2_2). The standard ALT activity assay does not
Claudia Billing et al.
Proteomics, 17(15-16) (2017-07-01)
Hematopoietic bone marrow is a regenerative tissue of high clinical relevance, yet relatively little is known about the metabolism of the stem and progenitor populations concerned. We have used a multipotent murine cell line to generate sufficient numbers of cells
Myriam M Chaumeil et al.
Cancer research, 74(16), 4247-4257 (2014-05-31)
Mutations of the isocitrate dehydrogenase 1 (IDH1) gene are among the most prevalent in low-grade glioma and secondary glioblastoma, represent an early pathogenic event, and are associated with epigenetically driven modulations of metabolism. Of particular interest is the recently uncovered

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej