Przejdź do zawartości
Merck
Wszystkie zdjęcia(3)

Kluczowe dokumenty

AV47897

Sigma-Aldrich

Anti-EXD antibody produced in rabbit

IgG fraction of antiserum

Synonim(y):

Anti-CG8933, Anti-DExd, Anti-Dm-EXD, Anti-Dmel_CG8933, Anti-Dpbx, Anti-EXD, Anti-Td48

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

IgG fraction of antiserum

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Formularz

buffered aqueous solution

masa cząsteczkowa

42 kDa

reaktywność gatunkowa

human, rat

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

numer dostępu UniProt

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

Drosophila melanogaster ... exd(32567)

Opis ogólny

Extradenticle (EXD) is a Drosophila transcription factor that regulates brain and eye development. It modulates the transcription network in the dorsal retinal rim and the FGF/branchless expression in mesodermal bridge cells.
Rabbit Anti-EXD antibody recognizes mouse, and rat EXD.

Immunogen

Synthetic peptide corresponding to a region of Fruit fly

Zastosowanie

Rabbit Anti-EXD antibody is suitable for western blot applications at a concentration of 5μg/ml.

Działania biochem./fizjol.

As a transcription factor, exd acts with the selector homeodomain proteins altering the regulation of downstream target genes such as wingless, teashirt and decapentaplegic. Thus exd affects segmental identity.

Sekwencja

Synthetic peptide located within the following region: EAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAAKKAAGA

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Wybierz jedną z najnowszych wersji:

Certyfikaty analizy (CoA)

Lot/Batch Number

Nie widzisz odpowiedniej wersji?

Jeśli potrzebujesz konkretnej wersji, możesz wyszukać konkretny certyfikat według numeru partii lub serii.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Mathias F Wernet et al.
Development (Cambridge, England), 141(4), 918-928 (2014-02-06)
A narrow band of ommatidia in the dorsal periphery of the Drosophila retina called the dorsal rim area (DRA) act as detectors for polarized light. The transcription factor Homothorax (Hth) is expressed in DRA inner photoreceptors R7 and R8 and
Samir Merabet et al.
EMBO reports, 6(8), 762-768 (2005-07-12)
The stereotyped outgrowth of tubular branches of the Drosophila tracheal system is orchestrated by the local and highly dynamic expression profile of branchless (bnl), which encodes a secreted fibroblast growth factor (FGF)-like molecule. Despite the importance of the spatial and

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej