AV43838

Anti-SLC7A1 antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-ATRC1, Anti-CAT-1, Anti-ERR, Anti-HCAT1, Anti-REC1L, Anti-Solute carrier family 7 (cationic amino acid transporter, y⁺ system), member 1
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 68 kDa
• reaktywność gatunkowa: human, rabbit, bovine
• stężenie: 0.5 mg - 1 mg/mL
• metody: western blot: suitable
• numer dostępu NCBI: NP_003036
• numer dostępu UniProt: P30825
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... SLC7A1(6541)

Opis

Opis ogólny

Solute carrier family 7 (cationic amino acid transporter, y+ system), member 1/ high affinity cationic amino acid transporter 1 (SLC7A1, ATRC1, CAT-1, ERR, REC1L) is a y+ system cationic amino acid transporter family member that supports arginine uptake and nitric oxide (NO) production. Mouse CAT-1 is a viral receptor for ecotropic murine leukemia virus (MLV) (eMLV), making it a model for study of retrovirus infection mechanisms and pathogenesis.

Specyficzność

Anti-SLC7A1 polyclonal antibody reacts with human and pig solute carrier family 7 (cationic amino acid transporter, y+ system), member 1 proteins.

Immunogen

Synthetic peptide directed towards the N terminal region of human SLC7A1

Zastosowanie

Anti-SLC7A1 polyclonal antibody is used to tag Solute carrier family 7 (cationic amino acid transporter, y+ system), member 1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 7 (cationic amino acid transporter, y+ system), member 1 in cationic amino acid uptake and retrovirus infection mechanisms and pathogenesis.

Działania biochem./fizjol.

SLC7A1 is a high-affinity, low capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine) in non-hepatic tissues. It may also function as an ecotropic retroviral leukemia receptor.

Sekwencja

Synthetic peptide located within the following region: LGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLNNDTKEGKPGVGGFMPF

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable