AV45004

Anti-CRELD1 antibody produced in rabbit

IgG fraction of antiserum

• Synonim(y): Anti-AVSD2, Anti-CIRRIN, Anti-Cysteine-rich with EGF-like domains 1, Anti-DKFZP566D213
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: IgG fraction of antiserum
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 45 kDa
• reaktywność gatunkowa: dog, guinea pig, bovine, horse, human
• stężenie: 0.5 mg - 1 mg/mL
• metody: immunohistochemistry: suitable; western blot: suitable
• numer dostępu NCBI: NP_001070883
• numer dostępu UniProt: Q96HD1
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... CRELD1(78987)

Opis

Opis ogólny

Cysteine-rich with EGF-like domains 1 (CRELD1), a highly conserved membrane bound extracellular protein that defines a new epidermal growth factor-related gene family, is a cell adhesion molecule associated with cardiac atrioventricular septal defects (AVSD) and congenital heart disease (CHD).

Specyficzność

Anti-CRELD1 polyclonal antibody detects canine, human, bovine, mouse, and and rat cysteine-rich with EGF-like domains 1 proteins.

Immunogen

Synthetic peptide directed towards the C terminal region of human CRELD1

Zastosowanie

Anti-CRELD1 polyclonal antibody is used to tag cysteine-rich with EGF-like domains 1 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of cysteine-rich with EGF-like domains 1 in cardiac diseases such as AVSD and CDH.

Działania biochem./fizjol.

Epidermal growth factor (EGF; MIM 131530)-like repeats are a class of cysteine-rich domains that mediate interactions between proteins of diverse function. EGF domains are found in proteins that are either completely secreted or have transmembrane regions that tether the protein to the cell surface. CRELD1 is the founding member of a family of matricellular proteins.

Sekwencja

Synthetic peptide located within the following region: TEVCPGENKQCENTEGGYRCICAEGYKQMEGICVKEQIPESAGFFSEMTE

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable