Przejdź do zawartości
Merck
Wszystkie zdjęcia(1)

Key Documents

AV44806

Sigma-Aldrich

Anti-USP48 (AB1) antibody produced in rabbit

affinity isolated antibody

Synonim(y):

Anti-DKFZp762M1713, Anti-MGC132556, Anti-MGC14879, Anti-RAP1GA1, Anti-USP31, Anti-Ubiquitin specific peptidase 48

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

70 kDa

reaktywność gatunkowa

rat, guinea pig, rabbit, dog, mouse, horse, human

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

numer dostępu UniProt

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... USP48(84196)

Immunogen

Synthetic peptide directed towards the C terminal region of human USP48

Zastosowanie

Anti-USP48 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Działania biochem./fizjol.

Ubiquitin specific peptidase 48 (USP48; USP31) is a deubiquitinating enzyme that belongs to C19 peptidase family. It recognizes and hydrolyzes the peptide bond of ubiquitin at the C-terminal glycine. USP48 reportedly interacts with p65/RelA subunits of NF-κB and regulates its activation.

Sekwencja

Synthetic peptide located within the following region: PQSGEWYKFNDEDIEKMEGKKLQLGIEEDLAEPSKSQTRKPKCGKGTHCS

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

K D Wilkinson
FASEB journal : official publication of the Federation of American Societies for Experimental Biology, 11(14), 1245-1256 (1997-12-31)
An astounding number of important regulatory and structural proteins are subject to modification by the attachment of ubiquitin or ubiquitin-like proteins. This modification acts as a targeting signal, delivering the modified protein to different locations in the cell and modifying
Christos Tzimas et al.
Cellular signalling, 18(1), 83-92 (2005-10-11)
TRAF2 mediates activation of the transcription factors NF-kappaB and AP1 by TNF. A yeast two-hybrid screen of a human cDNA library identified a ubiquitin specific protease homologue (USP31) as a TRAF2-interacting protein. Two cDNAs encoding for USP31 were identified. One

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej