AV44743
Anti-TGFBR2 antibody produced in rabbit
IgG fraction of antiserum
Synonim(y):
Anti-HNPCC6, Anti-MFS2, Anti-RIIC, Anti-Tbeta, Anti-Transforming growth factor, β receptor II (70/80 kDa)
Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
About This Item
Kod UNSPSC:
12352203
NACRES:
NA.41
Polecane produkty
pochodzenie biologiczne
rabbit
Poziom jakości
białko sprzężone
unconjugated
forma przeciwciała
IgG fraction of antiserum
rodzaj przeciwciała
primary antibodies
klon
polyclonal
Postać
buffered aqueous solution
masa cząsteczkowa
62 kDa
reaktywność gatunkowa
rabbit, human
stężenie
0.5 mg - 1 mg/mL
metody
western blot: suitable
numer dostępu NCBI
numer dostępu UniProt
Warunki transportu
wet ice
temp. przechowywania
−20°C
docelowa modyfikacja potranslacyjna
unmodified
informacje o genach
human ... TGFBR2(7048)
Opis ogólny
Transforming growth factor, β receptor II (70/80 kDa) (TGFBR2, HNPCC6, MFS2, RIIC) is a transmembrane ser/thr protein kinase family receptor for TGF-β (TGFB). TGFBR2 mediate TGF-β cell signaling to regulate/inhibit cell proliferation. Defective TGFBR2 is associated with Marfan syndrome.
Specyficzność
Anti-TGFBR2 polyclonal antibody reacts with bovine, rabbit, human, mouse, rat, and pig transforming growth factor, β receptor II proteins.
Immunogen
Synthetic peptide directed towards the N terminal region of human TGFBR2
Zastosowanie
Anti-TGFBR2 polyclonal antibody is used to tag transforming growth factor, β receptor II for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of transforming growth factor, β receptor II in TGF-β signaling and regulation of cell proliferation.
Działania biochem./fizjol.
TGFBR2 is a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. The protein is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in its gene have been associated with Marfan Syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors.This gene is a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. It encodes a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein and binds TGF-beta. This receptor/ligand complex phosphorylates proteins which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in this gene have been associated with Marfan Syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Sekwencja
Synthetic peptide located within the following region: MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSDVEMEAQKDEIICPSCNRT
Postać fizyczna
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Oświadczenie o zrzeczeniu się odpowiedzialności
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.
Nie możesz znaleźć właściwego produktu?
Wypróbuj nasz Narzędzie selektora produktów.
Kod klasy składowania
10 - Combustible liquids
Klasa zagrożenia wodnego (WGK)
WGK 3
Temperatura zapłonu (°F)
Not applicable
Temperatura zapłonu (°C)
Not applicable
Certyfikaty analizy (CoA)
Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.
Masz już ten produkt?
Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.
Hua Yu et al.
Experimental cell research, 362(2), 311-323 (2017-12-03)
Pulmonary arterial hypertension (PAH) is a devastating disease characterized by high pulmonary artery pressure. It is reported that microRNA-204 (miR-204) plays an important role in the development of PAH. Calcitriol [1,25-dihydroxyvitamin D3, 1,25(OH)
Hui Yang et al.
Scientific reports, 7, 41670-41670 (2017-02-15)
The human telomerase reverse transcriptase (hTERT) is highly expressed in a variety of tumors. The transforming growth factor beta receptor type II (TGFBR2) is a downstream protein of transforming growth factor beta (TGF-β) which suppresses telomerase activity. However, the relevance
Yarui Ma et al.
Clinical epigenetics, 12(1), 25-25 (2020-02-13)
Although massive studies have been conducted to investigate the mechanisms of esophageal squamous cell carcinoma (ESCC) carcinogenesis, the understanding of molecular alterations during the malignant transformation of epithelial dysplasia is still lacking, especially regarding epigenetic changes. To better characterize the
Daniel A Garcia et al.
Molecular cancer research : MCR, 16(7), 1172-1184 (2018-05-05)
Epithelial-mesenchymal transition (EMT) is a conserved cellular plasticity program that is reactivated in carcinoma cells and drives metastasis. Although EMT is well studied its regulatory mechanisms remain unclear. Therefore, to identify novel regulators of EMT, a data mining approach was
Mohammad Naji et al.
Scientific reports, 7(1), 14671-14671 (2017-11-09)
The heterogeneous and multifactorial essence of polycystic ovary syndrome (PCOS) renders a remarkable significance to microRNAs (miRNAs). Normo-androgenic (NA) and hyperandrogenic (HA) PCOS patients were compared with matched healthy women. Expression of miRNAs and TGFβ signaling genes was studied by
Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.
Skontaktuj się z zespołem ds. pomocy technicznej