Przejdź do zawartości
Merck
Wszystkie zdjęcia(3)

Kluczowe dokumenty

AV42248

Sigma-Aldrich

Anti-SLC6A8 antibody produced in rabbit

IgG fraction of antiserum

Synonim(y):

Anti-CRTR, Anti-CT1, Anti-MGC87396, Anti-Solute carrier family 6 (neurotransmitter transporter, creatine), member 8

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

IgG fraction of antiserum

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

70 kDa

reaktywność gatunkowa

human, mouse, bovine, horse, guinea pig, dog, rat

stężenie

0.5 mg - 1 mg/mL

metody

immunohistochemistry: suitable
western blot: suitable

numer dostępu NCBI

numer dostępu UniProt

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... SLC6A8(6535)

Opis ogólny

Solute carrier family 6 (neurotransmitter transporter, creatine), member 8/sodium- and chloride-dependent creatine transporter 1 (SLC6A8, CRTR, CT1) is required for the cellular uptake of creatine, which facilitates the storage of energy as ATP. Defects in SLC6A8/CRTR leads to creatine-deficiency syndrome evidenced by mental retardation and language delay.

Specyficzność

Anti-SLC6A8 polyclonal antibody reacts with bovine, canine, human, mouse, rat, pig, and rabbit sodium- and chloride-dependent creatine transporter 1 proteins

Immunogen

Synthetic peptide directed towards the N terminal region of human SLC6A8

Zastosowanie

Anti-SLC6A8 polyclonal antibody is used to tag solute carrier family 6 (neurotransmitter transporter, creatine), member 8for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 6 (neurotransmitter transporter, creatine), member 8 in creatine homeostasis and the development of creatine-deficiency syndrome.

Działania biochem./fizjol.

SLC6A8 is required for the uptake of creatine in muscles and brain.

Sekwencja

Synthetic peptide located within the following region: CDQLADRRSPVIEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFC

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Fernando Medina et al.
AIDS research and human retroviruses, 30(4), 370-379 (2013-12-11)
The human retrovirus human T cell lymphotropic virus type-I (HTLV-1) is the etiologic agent of HTLV-1-associated myelopathy/tropical spastic paraparesis (HAM/TSP). Axonal degeneration in HAM/TSP patients occurs without neuron infection, with the secreted viral Tax protein proposed to be involved. We
Hu Shan et al.
Molecular and cellular biochemistry, 397(1-2), 125-130 (2014-08-05)
Calreticulin (CRT) is a calcium-buffering protein which is predominantly located in endoplasmic reticulum. In the previous mitochondria proteome analysis, we accidentally found that CRT may be also localized at myocardial mitochondria and was upregulated in a rat model of furazolidone-induced

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej