AV40735

Anti-PRPF6 (AB2) antibody produced in rabbit

IgG fraction of antiserum

• Synonim(y): Anti-ANT-1, Anti-PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae), Anti-TOM
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: IgG fraction of antiserum
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Formularz: buffered aqueous solution
• masa cząsteczkowa: 104 kDa
• reaktywność gatunkowa: dog, guinea pig, human, bovine, rabbit, mouse, rat, horse
• stężenie: 0.5 mg - 1 mg/mL
• metody: western blot: suitable
• numer dostępu NCBI: NP_036601
• numer dostępu UniProt: O94906
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... PRPF6(24148)

Opis

Opis ogólny

PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae) (PRPF6) is involved in pre-mRNA spliceosome assembly by acting as a link between small nuclear ribonucleoproteins (snRNP) U5 snRNP and U4/U6 snRNP to form U4/U6-U5 tri-snPNP. Mutation of PRPF6 are linked to impairment of pre-mRNA splicing and autosomal-dominant retinitis pigmentosa.

Specyficzność

Anti-PRPF6 (AB2) polyclonal antibody reacts with bovine, human, mouse, rat, zebrafish, and canine PRP6 pre-mRNA processing factor 6 proteins.

Immunogen

Synthetic peptide directed towards the N terminal region of human PRPF6

Zastosowanie

Anti-PRPF6 (AB2) polyclonal antibody is used to tag PRP6 pre-mRNA processing factor 6 homolog for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of PRP6 pre-mRNA processing factor 6 homolog in spliceosome assembly and autosomal-dominant retinitis pigmentosa.

Działania biochem./fizjol.

PRPF6 appears to be involved in pre-mRNA splicing, possibly acting as a bridging factor between U5 and U4/U6 snRNPs in formation of the spliceosome. PRPF6 also can bind androgen receptor, providing a link between transcriptional activation and splicing.The protein encoded by this gene appears to be involved in pre-mRNA splicing, possibly acting as a bridging factor between U5 and U4/U6 snRNPs in formation of the spliceosome. The encoded protein also can bind androgen receptor, providing a link between transcriptional activation and splicing.

Sekwencja

Synthetic peptide located within the following region: PGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEE

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable