AV35459

Anti-KCNQ2 antibody produced in rabbit

IgG fraction of antiserum

• Synonim(y): Anti-Potassium voltage-gated channel, KQT-like subfamily, member 2
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: IgG fraction of antiserum
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 43 kDa
• reaktywność gatunkowa: human, horse, dog, mouse, bovine, guinea pig, rat
• stężenie: 0.5 mg - 1 mg/mL
• metody: immunohistochemistry: suitable; western blot: suitable
• numer dostępu NCBI: NP_004509
• numer dostępu UniProt: Q5VYU0
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... KCNQ2(3785)

Opis

Opis ogólny

Potassium voltage-gated channel subfamily Q member 2 (KCNQ2) gene, which codes for voltage-gated potassium channel subunits, is mostly expressed in the brain. KCNQ2 is made up of heteromultimeric channels with six transmembrane domains (S1–S6) in each subunit. It belongs to the voltage-gated potassium channels (KCNQ) gene subfamily. KCNQ2 gene is located on human chromosome 20q13.33.

Immunogen

Synthetic peptide directed towards the middle region of human KCNQ2

Działania biochem./fizjol.

Potassium voltage-gated channel subfamily Q member 2 (KCNQ2) plays a vital role in neurodevelopment. Mutations in the KCNQ2 gene are associated with benign familial neonatal infantile seizures (BFNIS), benign familial neonatal convulsions (BFNC), benign familial infantile seizures (BFIS), and neonatal onset epileptic encephalopathy (EE).

Sekwencja

Synthetic peptide located within the following region: GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYI

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable