Przejdź do zawartości
Merck
Wszystkie zdjęcia(2)

Key Documents

AV35165

Sigma-Aldrich

Anti-KCND3 antibody produced in rabbit

IgG fraction of antiserum

Synonim(y):

Anti-Potassium voltage-gated channel, Shal-related subfamily, member 3

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

IgG fraction of antiserum

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

70 kDa

reaktywność gatunkowa

rabbit, rat, guinea pig, human

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

numer dostępu UniProt

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... KCND3(3752)

Opis ogólny

KCND3 is a voltage-gated potassium (Kv) channel that is involved in the repolarization of the action potential. Genetic alterations in KCND3 have been associated with Brugada syndrome and sudden unexplained death.
Rabbit Anti-KCND3 antibody recognizes human, mouse, rat, rabbit, and pig KCND3.

Immunogen

Synthetic peptide directed towards the middle region of human KCND3

Zastosowanie

Rabbit Anti-KCND3 antibody is suitable for western blot applications at a concentration of 1.25 μg/ml.

Działania biochem./fizjol.

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). KCND3 encodes a member of the potassium channel, voltage-gated, shal-related subfamily, members of which form voltage-activated A-type potassium ion channels and are prominent in the repolarization phase of the action potential.

Sekwencja

Synthetic peptide located within the following region: KARLARIRVAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIE

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

John R Giudicessi et al.
Heart rhythm, 8(7), 1024-1032 (2011-02-26)
Brugada syndrome (BrS) is a sudden death-predisposing genetic condition characterized electrocardiographically by ST segment elevation in the leads V(1)-V(3). Given the prominent role of the transient outward current (I(to)) in BrS pathogenesis, we hypothesized that rare gain-of-function mutations in KCND3
John R Giudicessi et al.
Human mutation, 33(6), 989-997 (2012-03-30)
Heritable arrhythmia syndromes, including Brugada syndrome (BrS) and idiopathic ventricular fibrillation (IVF), may serve as the pathogenic basis for autopsy-negative sudden unexplained death (SUD) and sudden infant death syndrome (SIDS). Emerging evidence has linked perturbations in the transient outward current

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej