AV33271

Anti-SOX17 antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-SRY (sex determining region Y)-box 17
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Formularz: buffered aqueous solution
• masa cząsteczkowa: 44 kDa
• reaktywność gatunkowa: human, pig, dog
• stężenie: 0.5 mg - 1 mg/mL
• metody: western blot: suitable
• numer dostępu NCBI: NP_071899
• numer dostępu UniProt: Q9H6I2
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... SOX17(64321)

Opis

Opis ogólny

SRY-box (SOX) transcription factors bind the minor groove of DNA to modulate gene expression. SRY-box 17 (SOX17) regulates a variety of developmental processes such as endoderm formation. SOX17 is an antagonist to Wnt/β-catenin pathway cell signaling. SOX17 is a potential biomarker for breast cancer carcinogenesis and progression.

Specyficzność

Rabbit polyclonal anti-SOX17 antibody reacts with canine, human, and pig SRY (sex determining region Y)-box 17 transcription factors.

Immunogen

Synthetic peptide directed towards the C terminal region of human SOX17

Działania biochem./fizjol.

The SOX17 gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins.

Sekwencja

Synthetic peptide located within the following region: GTDPSQPAELLGEVDRTEFEQYLHFVCKPEMGLPYQGHDSGVNLPDSHGA

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable