AV32536

Anti-CCRN4L antibody produced in rabbit

IgG fraction of antiserum

• Synonim(y): Anti-CCR4 carbon catabolite repression 4-like (S. cerevisiae)
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: IgG fraction of antiserum
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 48 kDa
• reaktywność gatunkowa: human, horse, bovine, guinea pig
• stężenie: 0.5 mg - 1 mg/mL
• metody: immunohistochemistry: suitable; western blot: suitable
• numer dostępu NCBI: NP_036250
• numer dostępu UniProt: Q9UK39
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... CCRN4L(25819)

Opis

Opis ogólny

CCRN4L is a protein coding gene that is similar to a circadian clock gene, Nocturnin, and may be involved in regulating circadian functions.
Rabbit Anti-CCRN4L antibody recognizes bovine, rat, mouse, and human CCRN4L.

Immunogen

Synthetic peptide directed towards the N terminal region of human CCRN4L

Zastosowanie

Rabbit Anti-CCRN4L antibody can be used for western blot applications at a concentration of 1-2μg/ml. It can also be used for IHC assays at 4-8μg/ml, using paraffin-embedded tissues.

Działania biochem./fizjol.

CCRN4L is highly similar to Nocturnin, a gene identified as a circadian clock regulated gene in Xenopus laevis. This protein and Nocturnin protein share similarity with the C-terminal domain of a yeast transcription factor, carbon catabolite repression 4 (CCR4). The mRNA abundance of a similar gene in mouse has been shown to exhibit circadian rhythmicity, which suggests a role for this protein in clock function or as a circadian clock effector.

Sekwencja

Synthetic peptide located within the following region: LNSSAASQHPEYLVSPDPEHLEPIDPKELLEECRAVLHTRPPRFQRDFVD

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable