AV32386
Anti-SIRT1 antibody produced in rabbit
affinity isolated antibody
Synonim(y):
Anti-Sirtuin (silent mating type information Regulation 2 homolog) 1 (S. cerevisiae)
Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
About This Item
Kod UNSPSC:
12352203
NACRES:
NA.41
Polecane produkty
pochodzenie biologiczne
rabbit
Poziom jakości
białko sprzężone
unconjugated
forma przeciwciała
affinity isolated antibody
rodzaj przeciwciała
primary antibodies
klon
polyclonal
Postać
buffered aqueous solution
masa cząsteczkowa
82 kDa
reaktywność gatunkowa
rabbit, horse, guinea pig, rat, human, bovine, dog, mouse
stężenie
0.5 mg - 1 mg/mL
metody
western blot: suitable
numer dostępu NCBI
numer dostępu UniProt
Warunki transportu
wet ice
temp. przechowywania
−20°C
docelowa modyfikacja potranslacyjna
unmodified
informacje o genach
human ... SIRT1(23411)
Opis ogólny
Rabbit polyclonal anti-SIRT1 antibody reacts with chicken, human, mouse, rat, canine, and pig sirtuin-1 enzymes.
Sirtuin (silent mating type information regulation 2 homolog) 1 (S. cerevisiae) (SIRT1), a member of the NAD(+)-dependent protein deacetylase SIRT family, is involved in the regulation of nuclear transcription of genes involve in energy metabolism. SIRT1 provides a link between cellular energy status sensing (NAD(+) status) and the regulation of energy homoeostasis. SIRT1 is involved in the regulation of metabolism, cell differentiation and senescence, stress response, and cancer.
Immunogen
Synthetic peptide directed towards the N terminal region of human SIRT1
Zastosowanie
Rabbit Anti-SIRT1 antibody can be used for western blot applications at a concentration of 0.5μg/ml.
Rabbit polyclonal anti-SIRT1 antibody is used to tag sirtuin-1 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of sirtuin-1 in NAD(+) status-dependent energy homeostasis at the level of nuclear transcription control and protein deacetylation.
Działania biochem./fizjol.
SIRT1 is a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined;
Sekwencja
Synthetic peptide located within the following region: PETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKI
Postać fizyczna
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Oświadczenie o zrzeczeniu się odpowiedzialności
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.
Nie możesz znaleźć właściwego produktu?
Wypróbuj nasz Narzędzie selektora produktów.
Kod klasy składowania
10 - Combustible liquids
Klasa zagrożenia wodnego (WGK)
WGK 3
Temperatura zapłonu (°F)
Not applicable
Temperatura zapłonu (°C)
Not applicable
Certyfikaty analizy (CoA)
Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.
Masz już ten produkt?
Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.
Knut H Lauritzen et al.
Neurobiology of aging, 48, 34-47 (2016-09-18)
Mitochondrial genome maintenance plays a central role in preserving brain health. We previously demonstrated accumulation of mitochondrial DNA damage and severe neurodegeneration in transgenic mice inducibly expressing a mutated mitochondrial DNA repair enzyme (mutUNG1) selectively in forebrain neurons. Here, we
Éverton Lopes Vogt et al.
International journal of environmental research and public health, 18(14) (2021-07-25)
Introduction and objectives: Obesity represents a major global public health problem. Its etiology is multifactorial and includes poor dietary habits, such as hypercaloric and hyperlipidic diets (HFDs), physical inactivity, and genetic factors. Regular exercise is, per se, a tool for
Hongyi Zhang et al.
International journal of oncology, 45(5), 2143-2152 (2014-08-15)
MicroRNA (miRNA or miR) inhibition of oncogenic related pathways has been shown to be a promising therapeutic approach for cancer. SIRT1 might be a promoter factor on tumorigenesis of hepatocellular carcinoma (HCC). However, the mechanism is unknown. We investigated whether
Yan Li et al.
International journal of molecular medicine, 41(6), 3517-3526 (2018-03-14)
Mitochondrial dynamics have critical roles in aging, and their impairment represents a prominent risk factor for myocardial dysfunction. Mitochondrial deacetylase sirtuin (SIRT)3 contributes greatly to the prevention of redox stress and cell aging. The present study explored the role of SIRT3
Liang Lv et al.
Medical oncology (Northwood, London, England), 31(6), 965-965 (2014-05-13)
Sirtuin 1 (SIRT1) has been reported to have diverse roles in various biological processes through deacetylation of histone and nonhistone proteins. However, the correlations between SIRT1 protein expression, clinicopathological parameters, and survival of colorectal cancer patients remain unclear. SIRT1 protein
Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.
Skontaktuj się z zespołem ds. pomocy technicznej