Przejdź do zawartości
Merck
Wszystkie zdjęcia(1)

Key Documents

AV32186

Sigma-Aldrich

Anti-KLF3 antibody produced in rabbit

IgG fraction of antiserum

Synonim(y):

Anti-Kruppel-like factor 3 (basic)

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

IgG fraction of antiserum

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

39 kDa

reaktywność gatunkowa

rabbit, guinea pig, horse, human, bovine

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

numer dostępu UniProt

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... KLF3(51274)

Opis ogólny

KLF3 is a transcriptional factor that regulates muscle-specific genes. It is known to interact with serum response factor (SRF) through KLF binding sites.
Rabbit Anti-KLF3 antibody recognizes canine, human, mouse, rat, pig, chicken, and bovine KLF3.

Immunogen

Synthetic peptide directed towards the N terminal region of human KLF3

Zastosowanie

Rabbit Anti-KLF3 antibody can be used for western blot applications at a concentration of 1.25μg/ml.

Działania biochem./fizjol.

KLF3 is a zinc finger transcription factor that is known to function as a potent transcriptional repressor

Sekwencja

Synthetic peptide located within the following region: LSHGIQMEPVDLTVNKRSSPPSAGNSPSSLKFPSSHRRASPGLSMPSSSP

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Charis L Himeda et al.
Molecular and cellular biology, 30(14), 3430-3443 (2010-04-21)
This study identifies KLF3 as a transcriptional regulator of muscle genes and reveals a novel synergistic interaction between KLF3 and serum response factor (SRF). Using quantitative proteomics, KLF3 was identified as one of several candidate factors that recognize the MPEX
Agnes Fütterer et al.
Cell death & disease, 12(7), 637-637 (2021-06-23)
Embryonic stem cell (ESC) differentiation and somatic cell reprogramming are biological processes governed by antagonistic expression or repression of a largely common set of genes. Accurate regulation of gene expression is thus essential for both processes, and alterations in RNA

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej