Przejdź do zawartości
Merck
Wszystkie zdjęcia(1)

Kluczowe dokumenty

5127

Sigma-Aldrich

CD270 human

recombinant, expressed in E. coli, 0.5 mg protein/mL

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352200
NACRES:
NA.75

pochodzenie biologiczne

human

Poziom jakości

rekombinowane

expressed in E. coli

opis

0.1 mg recombinant human CD270 in 20 mM Tris-HCl buffer, containing NaCl, KCl, EDTA, L-arginine, DTT and glycerol.

sterylność

Filtered sterilized solution

Próba

≥90% (SDS-PAGE)

Formularz

liquid

opakowanie

pkg of 100 μg

stężenie

0.5 mg protein/mL

nr dostępu

NP_003811.2

numer dostępu UniProt

temp. przechowywania

−20°C

informacje o genach

human ... TNFRSF14(8764)

Zastosowanie

Coating a plate well (6 well plate) with this recombinant CD270 protein in a specific culture medium at 5-10 μg/well allows for use 1) as a coating matrix protein for human T or B cell functions and differentiation regulation studies in vitro, 2) as potential biomarker protein for infectious diseases and auto-immuno disease diagnostic development, or 3) as an antigen for specific antibody production.

Use this procedure as a guideline to determine optimal coating conditions for the culture system of choice.
1. Thaw CD270 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so the volume added covers the surface evenly (1-10 μg/well, 6 well plate).
2. Add appropriate amount of diluted material to culture surface.
3. Incubate at room temperature for approximately 1.5 hours.
4. Aspirate remaining material.
5. Rinse plates carefully with water and avoid scratching bottom surface of plates.
6. Plates are ready for use. They may also be stored at 2-8 °C damp or air dried if sterility is maintained.

Sekwencja

MASMTGGQQMGRGHHHHHHGNLYFQG^GEFLPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWV

Uwaga dotycząca przygotowania

The extracellular domain of recombinant human CD270 (39 - 202 aa) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal and expressed in E. coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 2

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Wybierz jedną z najnowszych wersji:

Certyfikaty analizy (CoA)

Lot/Batch Number

Przepraszamy, ale COA dla tego produktu nie jest aktualnie dostępny online.

Proszę o kontakt, jeśli potrzebna jest pomoc Obsługa Klienta

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Corinne Schaer et al.
PloS one, 6(4), e18495-e18495 (2011-05-03)
Tumor necrosis factor super family (TNFSF) members regulate important processes involved in cell proliferation, survival and differentiation and are therefore crucial for the balance between homeostasis and inflammatory responses. Several members of the TNFSF are closely associated with inflammatory bowel
R I Montgomery et al.
Cell, 87(3), 427-436 (1996-11-01)
We identified and cloned a cellular mediator of herpes simplex virus (HSV) entry. Hamster and swine cells resistant to viral entry became susceptible upon expression of a human cDNA encoding this protein, designated HVEM (for herpesvirus entry mediator). HVEM was
B S Kwon et al.
The Journal of biological chemistry, 272(22), 14272-14276 (1997-05-30)
The tumor necrosis factor receptor (TNFR) superfamily consists of approximately 10 characterized members of human proteins. We have identified a new member of the TNFR superfamily, TR2, from a search of an expressed sequence tag data base. cDNA cloning and

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej