219482

Caveolin-1 Scaffolding Domain Peptide, Cell-permeable

Caveolin-1 scaffolding domain peptide (C1-SD82-101) fused at the N-terminus to the cell-permeable Antennapedia internalization sequence (43-58).

• Synonim(y): Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, AP-Cav, Pen-C1-SD, RQIKIWFQNRRMKWKK-DGIWKASFTTFTVTKYWFYR, Cavtratin
• Wzór empiryczny (zapis Hilla): C₂₂₈H₃₃₅N₆₁O₄₉S
• Masa cząsteczkowa: 4746.54
• Kod UNSPSC: 12352202
• NACRES: NA.77

Właściwości

• Poziom jakości: 100
• Próba: ≥95% (HPLC)
• Formularz: lyophilized solid
• producent / nazwa handlowa: Calbiochem^®
• warunki przechowywania: OK to freeze; desiccated (hygroscopic); protect from light
• kolor: white
• rozpuszczalność: DMSO: 2 mg/mL
• Warunki transportu: wet ice
• temp. przechowywania: −20°C

Opis

Opis ogólny

Caveolin-1 scaffolding domain peptide (C1-SD_82-101) fused at the N-terminus to the cell-permeable Antennapedia internalization sequence (43-58). This peptide is reported to block eNOS activity and cellular NO release in vitro and reduce inflammation and tumorigenesis in vivo. Caveolin-1 interacts with several lipid-modified signaling ligands, such as EGFR, eNOS, G-protein α-subunits, PKCα, H-Ras, and Src, via the C1-SD_82-101 sequence.

Działania biochem./fizjol.

Cell permeable: yes

Primary Target
eNOS

Product does not compete with ATP.

Reversible: no

Opakowanie

Packaged under inert gas

Ostrzeżenie

Toxicity: Carcinogenic / Teratogenic (D)

Sekwencja

H-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Asp-Gly-Ile-Trp-Lys-Ala-Ser-Phe-Thr-Thr-Phe-Thr-Val-Thr-Lys-Tyr-Trp-Phe-Tyr-Arg-OH

Postać fizyczna

Supplied as a trifluoroacetate salt.

Rekonstytucja

Following reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.

Inne uwagi

Bernatchez, P.N., et al. 2005. Proc. Natl. Acad. Sci. USA102, 761.
Williams, T.M., et al. 2004. J. Biol. Chem.279, 51630.
Gratton, J.P., et al. 2003. Cancer Cell4, 31.
Sukumaran, S.K., et al. 2002. J. Biol. Chem.277, 50716.
Liu, J., et al. 2002. J. Biol. Chem.277, 10661.
Bucci, M., et al. 2000. Nat. Med.6, 1362.
Okamoto, T., et al. 1998. J. Biol. Chem.273, 5419.

Informacje prawne

CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 11 - Combustible Solids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable