06-847

Anti-EGFR Antibody

Upstate^®, from rabbit

• Synonim(y): Receptor tyrosine-protein kinase ErbB-1, avian erythroblastic leukemia viral (v-erb-b) oncogene homolog, cell growth inhibiting protein 40, cell proliferation-inducing protein 61, epidermal growth factor receptor, epidermal growth factor receptor (avian
• Kod UNSPSC: 12352203
• eCl@ss: 32160702
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• reaktywność gatunkowa: rat, hamster, mouse, human
• opakowanie: antibody small pack of 25 μg
• producent / nazwa handlowa: Upstate^®
• metody: immunoprecipitation (IP): suitable; western blot: suitable
• izotyp: IgG
• numer dostępu NCBI: NP_005219
• numer dostępu UniProt: P00533
• Warunki transportu: ambient
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: hamster ... Egfr(100774580) ; human ... EGFR(1956) ; mouse ... Egfr(13649) ; rat ... Egf(25313)

Opis

Opis ogólny

The epidermal growth factor receptor (EGFR; ErbB-1; HER1 in humans) is the cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands. The epidermal growth factor receptor is a member of the ErbB family of receptors, a subfamily of four closely related receptor tyrosine kinases: EGFR (ErbB-1), HER2/c-neu (ErbB-2), Her 3 (ErbB-3) and Her 4 (ErbB-4). Mutations affecting EGFR expression or activity could result in cancer. EGFR (epidermal growth factor receptor) exists on the cell surface and is activated by binding of its specific ligands, including epidermal growth factor and transforming growth factor α (TGFα). Upon activation by its growth factor ligands, EGFR undergoes a transition from an inactive monomeric form to an active homodimer. In addition to forming homodimers after ligand binding, EGFR may pair with another member of the ErbB receptor family, such as ErbB2/Her2/neu, to create an activated heterodimer. EGFR dimerization stimulates its intrinsic intracellular protein-tyrosine kinase activity. As a result, autophosphorylation of five tyrosine (Y) residues in the C-terminal domain of EGFR occurs.

Specyficzność

Recognizes the EGFR, Mr 180 kDa.

Reported to detect rat and hamster.

Immunogen

Ovalbumin conjugated synthetic peptide (ETKPNGIFKGPTAENAEYLRVAPPSSEFIGA) corresponding to amino acids 1156-1186 of the processed mouse EGF receptor (EGFR) C-terminal domain (Accession number Q01279). The immunizing sequence shares 28/31 identity with the human EGF receptor sequence.

Zastosowanie

Anti-EGFR Antibody detects level of EGFR & has been published & validated for use in IP & WB.

Immunoprecipitation:
4 µg of a previous lot immunoprecipitated the EGFR from 500 µg of a 3T3/A31 RIPA cell lysate.
Immunohistochemistry (Paraffin) Analysis: A 1:500 Dilution of this antibody detected EGFR in human placenta tissue sections.

Jakość

Routinely evaluated by western blot on a mouse 3T3/A31 RIPA cell lysate.

Western Blot Analysis:
0.5-2 µg/mL of this lot detected the EGFR from a mouse 3T3/A31 RIPA cell lysate.

Opis wartości docelowych

180 kDa

Powiązanie

Replaces: 04-337; 04-338

Postać fizyczna

Format: Purified

Purified rabbit polyclonal IgG in buffer containing 0.1M Tris-Glycine, 0.15M NaCl, 0.05% Sodium Azide, pH 7.4. Store at 2-8°C.

Przechowywanie i stabilność

Stable for 1 year at 2-8°C from date of receipt.

Handling Recommendations: Upon first thaw,
and prior to removing the cap, centrifuge the
vial and gently mix the solution.

Komentarz do analizy

Control
Positive Antigen Control: Catalog #12-305, 3T3/A31 lysate. Add 2.5 μL of 2-mercapto-ethanol/100 μL of lysate and boil for 5 minutes to reduce the preparation. Load 20 μg of reduced lysate per lane for minigels.

Inne uwagi

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.

Informacje prawne

UPSTATE is a registered trademark of Merck KGaA, Darmstadt, Germany

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 12 - Non Combustible Liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable