콘텐츠로 건너뛰기
Merck
모든 사진(7)

주요 문서

HPA020324

Sigma-Aldrich

Anti-RRP1B antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab2

동의어(들):

Anti-KIAA0179, Anti-Nnp1, Anti-PPP1R136, Anti-RRP1

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

양식

buffered aqueous glycerol solution

종 반응성

human

기술

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

면역원 서열

VLESEAGQPQALGSSGTCSSLKKQKLRAESDFVKFDTPFLPKPLFFRRAKSSTATHPPGPAVQLNKTPSSSKKVTFGLNRNMTAEFKKTDKSILVSPTGPSRVAFDPEQKPLHGVLKTPTSSPASSPLVAKKPLTT

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

일반 설명

Ribosomal RNA processing 1B (RRP1B) is a 52kDa protein mainly located in the nucleolus. It possesses a nucleolar protein of 52kDa (NOP52) homology domain and an RVxF (Arg/Lys-Val/Ile-Xaa-Phe/Trp) motif. The gene encoding RRP1B is localized to human chromosome 21.

면역원

Ribosomal RNA processing protein 1 homolog B recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-RRP1B antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige. Anti-RRP1B antibody produced in rabbit has been used for antigen array analysis.

생화학적/생리학적 작용

Ribosomal RNA processing 1B (RRP1B) is a metastasis modifier protein in breast cancer. It interacts with a metastasis modifier protein signal-induced proliferation-associated 1 (SIPA1) and functions in the reduction of tumor growth. The expression of RRP1B regulates many metastasis linked extra cellular matrix (ECM) genes which are associated with tumor suppression. The protein has an effect on gene expression by regulating histone methylation and heterochromatinization. Along with bromodomain-containing protein 4 (Brd4), RRP1B transduces extracellular mechanistic signals to the nucleus.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST73882

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Evolutionary breakpoints on human chromosome 21.
MT Davisson
Genomics, 78(1-2), 99-106 (2001)
Minnkyong Lee et al.
Molecular cancer research : MCR, 12(12), 1818-1828 (2014-08-06)
Overexpression of ribosomal RNA processing 1 homolog B (RRP1B) induces a transcriptional profile that accurately predicts patient outcome in breast cancer. However, the mechanism by which RRP1B modulates transcription is unclear. Here, the chromatin-binding properties of RRP1B were examined to
Delphine Chamousset et al.
Molecular biology of the cell, 21(23), 4212-4226 (2010-10-12)
A pool of protein phosphatase 1 (PP1) accumulates within nucleoli and accounts for a large fraction of the serine/threonine protein phosphatase activity in this subnuclear structure. Using a combination of fluorescence imaging with quantitative proteomics, we mapped the subnuclear localization
Santhoshi Rani Nanchari et al.
Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine, 36(2), 615-621 (2014-10-04)
Rrp1B (ribosomal RNA processing1 homolog B) is a novel candidate metastasis modifier gene in breast cancer. Functional gene assays demonstrated that a physical and functional interaction existing between Rrp1b and metastasis modifier gene SIPA1 causes reduction in the tumor growth
Jude Alsarraj et al.
PloS one, 8(11), e80746-e80746 (2013-11-22)
Recent studies suggest that BET inhibitors are effective anti-cancer therapeutics. Here we show that BET inhibitors are effective against murine primary mammary tumors, but not pulmonary metastases. BRD4, a target of BET inhibitors, encodes two isoforms with opposite effects on

Global Trade Item Number

SKUGTIN
HPA020324-100UL4061836314057
HPA020324-25UL4061842873821

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.