추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
IgG fraction of antiserum
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
48 kDa
종 반응성
human, rabbit, horse, rat, pig, mouse
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... ST3GAL5(8869)
면역원
Synthetic peptide directed towards the N terminal region of human ST3GAL5
애플리케이션
Anti-ST3GAL5 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml. It is also useful for immunohistochemistry at a concentration of 4-8μg/ml.
생화학적/생리학적 작용
ST3GAL5 (ST3 beta-galactoside alpha-2,3-sialyltransferase 5) gene also known as SIAT9, SIATGM3S, ST3GalV or GM3 synthase encodes for a Golgi type II membrane protein belongs to the glycosyltransferase family 29. ST3GAL5 plays a crucial role in the formation of GM3 using lactosylceramide as the substrate. Loss of function mutation in the ST3GAL5, encoding GM3 synthase results in incapability to synthesize alpha and beta series of gangliosides that may cause infantile epilepsy syndrome.
서열
Synthetic peptide located within the following region: DSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGS
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
M L Allende et al.
Glycobiology, 10(10), 1025-1032 (2000-10-13)
Ganglioside GM2 synthase and other enzymes required for complex ganglioside synthesis were localized recently to the trans Golgi network (TGN). However, there are conflicting reports as to the location of GM3 synthase; originally this enzyme was detected in the early
Michael A Simpson et al.
Nature genetics, 36(11), 1225-1229 (2004-10-27)
We identified an autosomal recessive infantile-onset symptomatic epilepsy syndrome associated with developmental stagnation and blindness. Assuming a founder effect in a large Old Order Amish pedigree, we carried out a genome-wide screen for linkage and identified a single region of
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.