추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
IgG fraction of antiserum
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
32 kDa
종 반응성
human, rat, rabbit, guinea pig, horse, mouse, bovine, dog
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... SDCBP(6386)
면역원
Synthetic peptide directed towards the middle region of human SDCBP
애플리케이션
Anti-SDCBP antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.
생화학적/생리학적 작용
Syndecan binding protein (SDCBP; syntenin, mda-9) is a scaffolding protein containing a PDZ domain that has functions that include cell adhesion, proliferation, protein trafficking, cytoskeletal organization and activation of transcription factors. It promotes metastasis of cancer cells by activating FAK, NF-κB, c-Src and p38-MAPK pathways.
서열
Synthetic peptide located within the following region: VGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLV
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Habib Boukerche et al.
Cancer research, 67(4), 1812-1822 (2007-02-20)
mda-9/Syntenin is a scaffolding PDZ domain-containing protein overexpressed in multiple human cancers that functions as a positive regulator of melanoma metastasis. Using a normal immortal human melanocyte cell line and weakly and highly metastatic human melanoma cell lines, we presently
Habib Boukerche et al.
Proceedings of the National Academy of Sciences of the United States of America, 105(41), 15914-15919 (2008-10-04)
The scaffold PDZ-domain containing protein mda-9/syntenin functions as a positive regulator of cancer cell progression in human melanoma and other tumors. mda-9/Syntenin regulates cell motility and invasion by altering defined biochemical and signaling pathways, including focal adhesion kinase (FAK), p38
Devanand Sarkar et al.
Cancer research, 68(9), 3087-3093 (2008-05-03)
Cancer is a progressive disease that, in many instances, if untreated, can culminate in metastatic spread of primary tumor cells to distant sites in the body. Metastasis frequently confers virulence and therapy resistance to cancer cells, and defining the molecular
Xiao-Long Qian et al.
PloS one, 8(3), e60046-e60046 (2013-03-28)
Syndecan binding protein (SDCBP), an adapter protein containing PDZ domains, contributes to the tumorigenicity and metastasis of many malignant tumors, such as malignant melanoma. Our study aimed in revealing the expression profile of SDCBP in breast cancer (BCa) and its
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.