콘텐츠로 건너뛰기
Merck
모든 사진(2)

주요 문서

AV44276

Sigma-Aldrich

Anti-CYBB antibody produced in rabbit

affinity isolated antibody

동의어(들):

Anti-CGD, Anti-Cytochrome b-245, β polypeptide (chronic granulomatous disease), Anti-GP91-1, Anti-GP91-PHOX, Anti-NOX2

로그인조직 및 계약 가격 보기


About This Item

MDL number:
UNSPSC 코드:
12352203
NACRES:
NA.41

결합

unconjugated

Quality Level

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

63 kDa

종 반응성

rabbit, mouse, human, rat

농도

0.5 mg - 1 mg/mL

기술

western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... CYBB(1536)

유사한 제품을 찾으십니까? 방문 제품 비교 안내

일반 설명

Cytochrome b-245 is a major component of the microbicidal oxidase system of human leucocytes including eosinophils, monocytes, macrophages and neutrophils. Cytochrome b-245 is thought to be the terminal component of the microbicidal oxidase electron transport chain leading to the respiratory burst of phagocytic neutrophil cells which generates superoxide-free radials. Defects in cytochrome b-245 have been linked to chronic granulomatous disease.

특이성

Anti-CγBB polyclonal antibody reacts with human, mouse, rat, bovine, chicken, rabbit, and canine cytochrome b-245 proteins.

면역원

Synthetic peptide directed towards the C terminal region of human CY24B

애플리케이션

Anti-CγBB polyclonal antibody is used to tag cytochrome b-245 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of cytochrome b-245 in microbicidal oxidase respiratory burst of phagocytic cells.

생화학적/생리학적 작용

Cytochrome b (-245) is composed of cytochrome b alpha (CYBA) and beta (CYBB) chain. It has been proposed as a primary component of the microbicidal oxidase system of phagocytes. CYBB deficiency is one of five described biochemical defects associated with chronic granulomatous disease (CGD). In this disorder, there is decreased activity of phagocyte NADPH oxidase; neutrophils are able to phagocytize bacteria but cannot kill them in the phagocytic vacuoles. The cause of the killing defect is an inability to increase the cell's respiration and consequent failure to deliver activated oxygen into the phagocytic vacuole.

서열

Synthetic peptide located within the following region: IASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.