AV48526

Anti-TRMT11 antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-C6orf75, Anti-MDS024, Anti-TRM11, Anti-dJ187J11, Anti-dJ187J11.2, Anti-tRNA methyltransferase 11 homolog (S. cerevisiae)
• Codice UNSPSC: 12352203

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 53 kDa
• Reattività contro le specie: human, mouse, horse, bovine, dog, rabbit, rat, guinea pig
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_001026882
• N° accesso UniProt: Q7Z4G4
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... TRMT11(60487)

Descrizione

Descrizione generale

TRMT11-1 codes for tRNA Methyltransferase 11 homolog (S. cerevisiae). It may be involved in the processing of tRNA. Genetic variation in TRMT11 has been analyzed as a biomarker to predict the efficacy of androgen deprivation therapy in prostate cancer patients.
Rabbit Anti-TRMT11 antibody recognizes human, mouse, rat, chicken, canine, and bovine TRMT11.

Immunogeno

Synthetic peptide directed towards the N terminal region of human TRMT11

Applicazioni

Rabbit Anti-TRMT11 antibody is suitable for western blot applications at a concentration of 1μg/ml.

Azioni biochim/fisiol

TRMT11 belongs to the methyltransferase superfamily. It is a catalytic subunit of an S-adenosyl-L-methionine-dependent tRNA methyltransferase complex that mediates the methylation of the guanosine nucleotide at position 10 (m2G10) in tRNAs.

Sequenza

Synthetic peptide located within the following region: IKIHTFNKTLTQEEKIKRIDALEFLPFEGKVNLKKPQHVFSVLEDYGLDP

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable