Passa al contenuto
Merck
Tutte le immagini(3)

Key Documents

AV47410

Sigma-Aldrich

Anti-TMEM30A antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-C6orf67, Anti-CDC50A, Anti-FLJ10856, Anti-Transmembrane protein 30A

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(3)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

PM

41 kDa

Reattività contro le specie

human, dog, guinea pig, horse, rat, mouse

Concentrazione

0.5 mg - 1 mg/mL

tecniche

immunohistochemistry: suitable
western blot: suitable

N° accesso NCBI

NP_060717

N° accesso UniProt

Q9NV96

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... TMEM30A(55754)

Categorie correlate

Descrizione generale

TMEM30A codes for a transmembrane protein that is present in the endoplasmic reticulum. Studies have reported that TMEM30A facilitates the import of bioactive and anticancer phospholipids into mammalian cells.
Rabbit Anti-TMEM30A recognizes human, mouse, rat, zebrafish, chicken, canine, and bovine TMEM30A.

Immunogeno

Synthetic peptide directed towards the middle region of Human TMEM30A

Applicazioni

Rabbit Anti-TMEM30A antibody is suitable for western blot applications at a concentration of 0.25 μg/ml and for immunohistochemistry at 4-8 μg/ml.

Azioni biochim/fisiol

The function of this protein remains unknown.

Sequenza

Synthetic peptide located within the following region: FTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKEC

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Rui Chen et al.
Journal of immunology (Baltimore, Md. : 1950), 186(5), 3215-3225 (2011-02-04)
Antitumor alkylphospholipids initiate apoptosis in transformed HL-60 and Jurkat cells while sparing their progenitors. 1-O-Alkyl-2-carboxymethyl-sn-glycero-3-phosphocholine (Edelfosine) like other short-chained phospholipids--inflammatory platelet-activating factor (PAF) and apoptotic oxidatively truncated phospholipids--are proposed to have intracellular sites of action, yet a conduit for these
Fan Yang et al.
Haematologica, 104(10), 1984-1994 (2019-03-02)
Transmembrane protein 30A (Tmem30a) is the β-subunit of P4-ATPases which function as flippase that transports aminophospholipids such as phosphatidylserine from the outer to the inner leaflets of the plasma membrane to maintain asymmetric distribution of phospholipids. It has been documented

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.