AV37905

Anti-MyBBP1A antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-AL024407, Anti-AU019902, Anti-MyB binding protein (P160) 1a, Anti-P160, Anti-p160MBP, Anti-p67MBP
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 152 kDa
• Reattività contro le specie: mouse, human
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_058056
• N° accesso UniProt: Q7TPV4
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: mouse ... Mybbp1a(18432)

Descrizione

Descrizione generale

MyB binding protein (P160) 1a (MyBBP1A), a c-myb proto-oncogene product (c-Myb)-interacting protein, is post-translationally processed to 67 kDa fragment (p67MBP). MyBBP1A is primarily expressed in the nucleoli. MyBBP1A which is associated with RNA Polymerase 1 complex and ribosome biogenesis machinery regulates rRNA metabolism and is believed to connect the process of ribosome biogenesis and Myb-dependent transcription to regulate/coordinate cell cycle progression and proliferation.

Specificità

Anti-MyBBP1A polyclonal antibody reacts with human, rat, and mouse MyB binding protein (P160) 1a proteins.

Immunogeno

Synthetic peptide directed towards the C terminal region of mouse Mybbp1a

Applicazioni

Anti-MyBBP1A polyclonal antibody is used to tag MyB binding protein (P160) 1a protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of MyB binding protein (P160) 1a in the coordination and regulation of rRNA biosynthesis and ribosome biogenesis.

Azioni biochim/fisiol

Mybbp1a may activate or repress transcription via interactions with sequence specific DNA-binding proteins. Repression may be mediated at least in part by histone deacetylase activity.

Sequenza

Synthetic peptide located within the following region: HSSGSNRLYDLYWQAMRMLGVQRPKSEKKNAKDIPSDTQSPVSTKRKKKG

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 2
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable