AV43962

Anti-SLC25A39 antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-CGI-69, Anti-CGI69, Anti-FLJ22407, Anti-Solute carrier family 25, member 39
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 39 kDa
• Reattività contro le specie: human, horse, rat, mouse, guinea pig, rabbit, bovine, dog
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunohistochemistry: suitable; western blot: suitable
• N° accesso NCBI: NP_001137252
• N° accesso UniProt: Q9BZJ4-2
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... SLC25A39(51629)

Descrizione

Descrizione generale

Solute carrier family 25, member 39 (SLC25A39, CGI69) is a member of the SLC25 carrier family that mediates transport across the inner mitochondrial membrane. SLC25A39 may be involve in the incorporation of iron into protoporphyrin IX, an essential step in heme biosynthesis.

Specificità

Anti-SLC25A39 polyclonal antibody reacts with human, mouse, rat, canine, bovine, and zebrafish solute carrier family 25, member 39 proteins.

Immunogeno

Synthetic peptide directed towards the C terminal region of human SLC25A39

Applicazioni

Anti-SLC25A39 polyclonal antibody is used to tag solute carrier family 25, member 39 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 25, member 39 in mitochondrial transport in support of iron-dependent processes such as heme biosynthesis.

Azioni biochim/fisiol

SLC25A39 is a member of the solute carrier family 25 and is known to transport molecules over the mitochondrial membrane.

Sequenza

Synthetic peptide located within the following region: RVNPLHVDSTWLLLRRIRAESGTKGLFAGFLPRIIKAAPSCAIMISTYEF

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable