Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

WH0010461M1

Sigma-Aldrich

Monoclonal Anti-MERTK antibody produced in mouse

clone 2D2, purified immunoglobulin, buffered aqueous solution

Sinonimo/i:

Anti-MER, Anti-c-mer proto-oncogene tyrosine kinase, Anti-cmer

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

mouse

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

2D2, monoclonal

Stato

buffered aqueous solution

Reattività contro le specie

human

tecniche

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG1κ

N° accesso Genebanck

N° accesso UniProt

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... MERTK(10461)

Categorie correlate

Descrizione generale

The gene MERTK (MER proto-oncogene, tyrosine kinase) is mapped to human chromosome 2q14.1. The encoded protein belongs to the Tyro3, Axl, and Mertk (TAM) family of receptor tyrosine kinases. MERTK is strongly expressed in macrophages, ovary, prostate, testis, lung and kidney. The protein has a conserved intracellular kinase domain and an extracellular adhesion molecule-like domain.

Immunogeno

MERTK (NP_006334, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
AITEAREEAKPYPLFPGPFPGSLQTDHTPLLSLPHASGYQPALMFSPTQPGRPHTGNVAIPQVTSVESKPLPPLAFKHTVGHIILSEHKGVKFNCSINVP

Azioni biochim/fisiol

MERTK (MER proto-oncogene, tyrosine kinase) is mainly involved in the starting of efferocytosis, which is the removal of dying cells by phagocytosis. It interacts with two ligands, Gas6 (growth arrest-specific 6) and Protein-S. Mutation in this gene regulates the severity of fibrosis in patients with non-alcoholic fatty liver disease. Mutations in MERTK gene also result in autosomal recessive retinal degeneration due to faults in phagocytosis. MERTK is upregulated in malignant cells, including leukemia, lymphoma and colorectal cancer. Variants of this gene are detected in melanoma, multiple myeloma, renal cancer and carcinoma. MERTK is also overexpressed in sclerotic lesions.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

A novel start codon mutation of the MERTK gene in a patient with retinitis pigmentosa.
Jinda W
Molecular Vision, 342-351 (2016)
Human iPSC derived disease model of MERTK-associated retinitis pigmentosa.
Lukovic D, et.al
Scientific Reports, 5, 12910-12910 (2015)
MERTK rs4374383 polymorphism affects the severity of fibrosis in non-alcoholic fatty liver disease.
Petta S
Journal of Hepatology, 64(3), 682-690 (2016)
A Comprehensive Review of Mutations in the MERTK Proto-Oncogene.
Parinot C and Nandrot EF
Advances in Experimental Medicine and Biology, 854, 259-265 (2016)
Dunja Lukovic et al.
Scientific reports, 5, 12910-12910 (2015-08-12)
Retinitis pigmentosa (RP) represents a genetically heterogeneous group of retinal dystrophies affecting mainly the rod photoreceptors and in some instances also the retinal pigment epithelium (RPE) cells of the retina. Clinical symptoms and disease progression leading to moderate to severe

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.