SAB5702005

Anti-Bak Antibody, clone 7Q3T8, Rabbit Monoclonal

• Sinonimo/i: BAK1,BAK,BAK-LIKE,BCL2L7
• Codice UNSPSC: 12352203
• NACRES: NA.46
• Clone: 7Q3T8, monoclonal
• application: IHC; WB
• Reattività contro le specie: mouse, mouse
• tecniche: immunohistochemistry: 1:50 - 1:100; western blot: 1:500 - 1:2000

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Materiali: colorless
• Clone: 7Q3T8, monoclonal
• Stato: liquid
• PM: 25 kDa
• Reattività contro le specie: mouse, mouse
• Concentrazione: 0.089 mg/mL
• tecniche: immunohistochemistry: 1:50 - 1:100; western blot: 1:500 - 1:2000
• Colore: colorless
• Isotipo: IgG
• Sequenza immunogenica: RQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIG
• N° accesso UniProt: Q16611
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... BAK1(578)

Descrizione

Descrizione generale

The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mitochondria, and functions to induce apoptosis. It interacts with and accelerates the opening of the mitochondrial voltage-dependent anion channel, which leads to a loss in membrane potential and the release of cytochrome c. This protein also interacts with the tumor suppressor P53 after exposure to cell stress.

Immunogeno

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Recombinant fusion protein containing a sequence corresponding to amino acids 11-82 of human Bak (NP_001179.1).

Applicazioni

WB, IHC

Informazioni sulla sicurezza

• Pittogrammi: GHS07,GHS09
• Avvertenze: Warning
• Indicazioni di pericolo: H317,H411
• Consigli di prudenza: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Classi di pericolo: Aquatic Chronic 2 - Skin Sens. 1
• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3