Passa al contenuto
Merck
Tutte le immagini(3)

Documenti fondamentali

SAB1412644

Sigma-Aldrich

ANTI-ATF3 antibody produced in mouse

clone 7G10, purified immunoglobulin, buffered aqueous solution

Sinonimo/i:

ATF3

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

mouse

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

7G10, monoclonal

Stato

buffered aqueous solution

PM

antigen 45.65 kDa

Reattività contro le specie

human

tecniche

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG1κ

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... ATF3(467)

Descrizione generale

Activating transcription factor 3 (ATF3) is encoded by the gene mapped to human chromosome 1q. It belongs to the ATF/cAMP response element binding (CREB) family of transcription factors. The encoded protein contains a basic region involved in specific DNA binding, and a leucine zipper (bZIP) motif responsible for forming homodimers or heterodimers with other bZIP-containing proteins. ATF3 protein is expressed at low levels in normal and quiescent cells, but its expression is triggered on exposure to extracellular signals such as, growth factors, cytokines and some genotoxic stress agents.
Activating transcription factor 3 is a member of the mammalian activation transcription factor/cAMP responsive element-binding (CREB) protein family of transcription factors. Multiple transcript variants encoding two different isoforms have been found for this gene. The longer isoform represses rather than activates transcription from promoters with ATF binding elements. The shorter isoform (deltaZip2) lacks the leucine zipper protein-dimerization motif and does not bind to DNA, and it stimulates transcription presumably by sequestering inhibitory co-factors away from the promoter. It is possible that alternative splicing of the ATF3 gene may be physiologically important in the regulation of target genes. (provided by RefSeq)

Immunogeno

ATF3 (AAH06322, 1 a.a. ~ 181 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS

Azioni biochim/fisiol

Activating transcription factor 3 (ATF3) plays a vital role as a novel neuronal marker of nerve injury in the nervous system. ATF3 negatively regulates toll-like receptors (TLR)-stimulated inflammatory response. The encoded protein possibly plays an essential role in homeostasis, wound healing, cell adhesion, cancer cell invasion, apoptosis and signaling pathways. Over-expression of this protein stops cell cycle progression. Increased expression of ATF3 on exposure to stress signals or DNA damage, is regulated by various signaling pathway including, p53-dependent and -independent pathways, and may also involve mitogen-activated protein (MAP) kinase signaling pathways.
ATF3 plays bifurcated roles in cancer development by stimulating apoptosis in the untransformed MCF10A (a breast cancer progression cell line) mammary epithelial cells and also conserve aggressive MCF10CA1a cells and promotes its cell motility.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

H Tsujino et al.
Molecular and cellular neurosciences, 15(2), 170-182 (2000-02-16)
Activating transcription factor 3 (ATF3), a member of ATF/CREB family of transcription factors, is induced in a variety of stressed tissue. ATF3 regulates transcription by binding to DNA sites as a homodimer or heterodimer with Jun proteins. The purpose of
Matthew R Thompson et al.
Journal of molecular medicine (Berlin, Germany), 87(11), 1053-1060 (2009-08-26)
Activating transcription factor 3 (ATF3) is a member of the ATF/cyclic AMP response element-binding (ATF/CREB) family of transcription factors. It is an adaptive-response gene that participates in cellular processes to adapt to extra- and/or intracellular changes, where it transduces signals
X Yin et al.
Oncogene, 27(15), 2118-2127 (2007-10-24)
Activating transcription factor 3 (ATF3) is a member of the ATF/cyclic AMP response element-binding family of transcription factors. We present evidence that ATF3 has a dichotomous role in cancer development. By both gain- and loss-of-function approaches, we found that ATF3
Mark Gilchrist et al.
Nature, 441(7090), 173-178 (2006-05-12)
The innate immune system is absolutely required for host defence, but, uncontrolled, it leads to inflammatory disease. This control is mediated, in part, by cytokines that are secreted by macrophages. Immune regulation is extraordinarily complex, and can be best investigated
T Hai et al.
Gene expression, 7(4-6), 321-335 (1999-08-10)
The purpose of this review is to discuss ATF3, a member of the ATF/CREB family of transcription factors, and its roles in stress responses. In the introduction, we briefly describe the ATF/CREB family, which contains more than 10 proteins with

Global Trade Item Number

SKUGTIN
SAB1412644-100UG4061829666187

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.