SAB1412289

ANTI-MSX1 antibody produced in mouse

clone 3A8, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: HOX7, HYD1, MSX1
• Codice UNSPSC: 12352203
• NACRES: NA.43

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 3A8, monoclonal
• Forma fisica: buffered aqueous solution
• PM: antigen 34.65 kDa
• Reattività contro le specie: human
• tecniche: immunoprecipitation (IP): suitable; indirect ELISA: suitable
• Isotipo: IgG2aκ
• N° accesso NCBI: NM_002448
• N° accesso UniProt: P28360
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... MSX1(4487)

Descrizione

Descrizione generale

This gene encodes a member of the muscle segment homeobox gene family. The encoded protein functions as a transcriptional repressor during embryogenesis through interactions with components of the core transcription complex and other homeoproteins. It may also have roles in limb-pattern formation, craniofacial development, particularly odontogenesis, and tumor growth inhibition. Mutations in this gene, which was once known as homeobox 7, have been associated with nonsyndromic cleft lip with or without cleft palate 5, Witkop syndrome, Wolf-Hirschom syndrome, and autosomoal dominant hypodontia. (provided by RefSeq)

Immunogeno

MSX1 (NP_002439, 216 a.a. ~ 297 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
NRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQRAALPVAPVGLYTAHVGYSMYHLT

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable