Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

SAB1410940

Sigma-Aldrich

Anti-IL23A antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

Sinonimo/i:

IL-23, IL-23A, IL23P19, MGC79388, P19, SGRF

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

antigen 20.7 kDa

Reattività contro le specie

human

tecniche

western blot: 1 μg/mL

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... IL23A(51561)

Descrizione generale

Interleukin 23 subunit α (IL23A) gene with 4 exons, spanning 1531bp of genomic DNA, is mapped to human chromosome 12q13.2. The gene codes for a 19kDa cytokine, p19. The protein consists of a signal peptide and mature peptide composed of four α helices.
This gene encodes a subunit of the heterodimeric cytokine interleukin 23 (IL23). IL23 is composed of this protein and the p40 subunit of interleukin 12 (IL12B). The receptor of IL23 is formed by the β1 subunit of IL12 (IL12RB1) and an IL23 specific subunit, IL23R. Both IL23 and IL12 can activate the transcription activator STAT4, and stimulate the production of interferon-γ(IFNG). In contrast to IL12, which acts mainly on naive CD4+ T cells, IL23 preferentially acts on memory CD4+ T cells. (provided by RefSeq)

Immunogeno

IL23A (NP_057668.1, 1 a.a. ~ 189 a.a) full-length human protein.

Sequence
MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP

Azioni biochim/fisiol

Interleukin 23 subunit α (IL23A) plays a vital role downstream of the Janus kinase/signal transducers and activators of transcription (JAK/STAT) pathway, that transduces signals for cell proliferation, differentiation, cell migration and apoptosis. Elevated expression of IL23A has been observed in meibomian cell carcinoma (MCC). Mutation in the gene increases the risk of susceptibility to psoriatic arthritis (PsA) as well as psoriasis.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

IL23A (interleukin 23, alpha subunit p19)
Norimitsu Inoue
Atlas of Genetics and Cytogenetics in Oncology and Haematology, 1-4 (2010)
John Bowes et al.
Annals of the rheumatic diseases, 70(9), 1641-1644 (2011-05-31)
To investigate a shared genetic aetiology for skin involvement in psoriasis and psoriatic arthritis (PsA) by genotyping single-nucleotide polymorphisms (SNPs), reported to be associated in genome-wide association studies of psoriasis, in patients with PsA. SNPs with reported evidence for association
Arun Kumar et al.
Genomics, 90(5), 559-566 (2007-09-25)
Meibomian cell carcinoma (MCC) is a malignant tumor of the meibomian glands located in the eyelids. No information exists on the cytogenetic and genetic aspects of MCC. There is no report on the gene expression profile of MCC. Thus there
J Niu et al.
Clinical and experimental immunology, 176(3), 473-484 (2014-02-18)
Hepatic allograft rejection remains a challenging problem, with acute rejection episode as the major barrier for long-term survival in liver transplant recipients. To explore a strategy to prevent allograft rejection, we hypothesized that mesenchymal stem cells (MSCs) genetically engineered with
María Florencia Ogara et al.
Biochimica et biophysica acta, 1843(7), 1309-1324 (2014-04-08)
DNA damage, which perturbs genomic stability, has been linked to cognitive decline in the aging human brain, and mutations in DNA repair genes have neurological implications. Several studies have suggested that DNA damage is also increased in brain disorders such

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.