SAB1409794

Monoclonal Anti-WT1 antibody produced in mouse

clone 1A12, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: GUD, WAGR, WIT-2, WT33
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 1A12, monoclonal
• Forma fisica: buffered aqueous solution
• PM: antigen 35.64 kDa
• Reattività contro le specie: human
• tecniche: immunofluorescence: suitable; indirect ELISA: suitable
• Isotipo: IgG2bκ
• N° accesso NCBI: NM_000378
• N° accesso UniProt: P19544
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... WT1(7490)

Descrizione

Descrizione generale

This gene encodes a transcription factor that contains four zinc-finger motifs at the C-terminus and a proline/glutamine-rich DNA-binding domain at the N-terminus. It has an essential role in the normal development of the urogenital system, and it is mutated in a small subset of patients with Wilm′s tumors. Multiple transcript variants, resulting from alternative splicing at two coding exons, have been well characterized. There is also evidence for the use of non-AUG (CUG) translation initiation site upstream of, and in-frame with the first AUG, leading to additional isoforms. Authors of PMID:7926762 also provide evidence that WT1 mRNA undergoes RNA editing in human and rat, and that this process is tissue-restricted and developmentally regulated. (provided by RefSeq)

Immunogeno

WT1 (NP_000369.3, 349 a.a. ~ 439 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTC

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable