Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

SAB1403512

Sigma-Aldrich

Monoclonal Anti-MUC5B antibody produced in mouse

clone 8C11, ascites fluid

Sinonimo/i:

MG1, MUC5, MUC9

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

mouse

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

ascites fluid

Tipo di anticorpo

primary antibodies

Clone

8C11, monoclonal

PM

antigen ~38.21 kDa

Reattività contro le specie

human

tecniche

indirect ELISA: suitable
western blot: 1:500-1:1000

Isotipo

IgG2aκ

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... MUC5B(727897)

Categorie correlate

Descrizione generale

Mucin 5B (MUC5B) is a high molecular mass, heavily O-glycosylated gel-forming mucin. It is encoded by the gene mapped to human chromosome 11p15.5. MUC5B is found in bronchus glands, submaxillary glands, endocervix, gall bladder, and pancreas.

Immunogeno

MUC5B (XP_039877.9, 4186 a.a. ~ 4295 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
CEEDSCQVRINTTILWHQGCETEVNITFCEGSCPGASKYSAEAQAMQHQCTCCQERRVHEETVPLHCPNGSAILHTYTHVDECGCTPFCVPAPMAPPHTRGFPAQEATAV

Applicazioni

Monoclonal Anti-MUC5B antibody produced in mouse has been used in immunofluorescence .

Azioni biochim/fisiol

MUC5B is salivary mucin that might contribute to the lubrication, hydration, pathogen exclusion, and viscoelastic properties of the whole saliva. The protein acts as a marker of mucous gland cells. Mouse MUC5B plays a vital role in maintaining immune homeostasis in the lungs. It is also involved in preventing infections in the airways and middle ear by facilitating mucociliary clearance (MCC). Mutation in the MUC5B gene leads to the development of idiopathic pulmonary fibrosis. Overexpression of the gene stimulates aggressive behavior of breast cancer MCF7 cells.

Stato fisico

Clear solution

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

11 - Combustible Solids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Hélène Valque et al.
PloS one, 7(10), e46699-e46699 (2012-10-12)
The mucin MUC5B has a critical protective function in the normal lung, salivary glands, esophagus, and gallbladder, and has been reported to be aberrantly expressed in breast cancer, the second leading cause of cancer-related deaths among women worldwide. To understand
Shinji Sumiyoshi et al.
Lung cancer (Amsterdam, Netherlands), 84(3), 281-288 (2014-04-15)
The characteristics of non-terminal respiratory unit (TRU) type lung adenocarcinoma are still unclear. The aim of the present study was to characterize non-TRU type lung adenocarcinoma. We analyzed the expression of mucins MUC5B and MUC5AC, as well as thyroid transcription
Grant E Duclos et al.
Science advances, 5(12), eaaw3413-eaaw3413 (2019-12-18)
The human bronchial epithelium is composed of multiple distinct cell types that cooperate to defend against environmental insults. While studies have shown that smoking alters bronchial epithelial function and morphology, its precise effects on specific cell types and overall tissue
Lina M Salazar-Peláez et al.
PloS one, 10(3), e0119717-e0119717 (2015-03-15)
Vitronectin, a multifunctional glycoprotein, is involved in coagulation, inhibition of the formation of the membrane attack complex (MAC), cell adhesion and migration, wound healing, and tissue remodeling. The primary cellular source of vitronectin is hepatocytes; it is not known whether
Heather S Davies et al.
PloS one, 9(9), e108372-e108372 (2014-09-30)
The salivary mucins that include MUC5B (gel-forming) and MUC7 (non-gel-forming) are major contributors to the protective mucus barrier in the oral cavity, and it is possible that dietary components may influence barrier properties. We show how one dietary compound, the

Global Trade Item Number

SKUGTIN
SAB1403512-200UL4061838057310

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.