SAB1402820

Monoclonal Anti-IL4R antibody produced in mouse

clone 1D3, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: CD124, IL4RA
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 1D3, monoclonal
• Forma fisica: buffered aqueous solution
• PM: antigen ~38.21 kDa
• Reattività contro le specie: human
• tecniche: capture ELISA: suitable; indirect ELISA: suitable
• Isotipo: IgG2aκ
• N° accesso NCBI: NM_000418
• N° accesso UniProt: P24394
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... IL4R(3566)

Descrizione

Descrizione generale

This gene encodes the alpha chain of the interleukin-4 receptor, a type I transmembrane protein that can bind interleukin 4 and interleukin 13 to regulate IgE production. The encoded protein also can bind interleukin 4 to promote differentiation of Th2 cells. A soluble form of the encoded protein can be produced by an alternate splice variant or by proteolysis of the membrane-bound protein, and this soluble form can inhibit IL4-mediated cell proliferation and IL5 upregulation by T-cells. Allelic variations in this gene have been associated with atopy, a condition that can manifest itself as allergic rhinitis, sinusitus, asthma, or eczema. Two transcript variants encoding different isoforms, a membrane-bound and a soluble form, have been found for this gene. (provided by RefSeq)

Immunogeno

IL4R (NP_000409, 26 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNV

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable