MSST0059
SILu™Prot CST3, Cystatin C human
recombinant, expressed in E. coli, SIL MS Protein Standard, 15N-labeled
Sinonimo/i:
CST3, Cystatin C
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Codice UNSPSC:
23201100
NACRES:
NA.32
Prodotti consigliati
Ricombinante
expressed in E. coli
Livello qualitativo
Saggio
≥95% (SDS-PAGE)
Stato
lyophilized powder
Potenza
≥97% (Heavy amino acids incorporation efficiency by MS)
Compatibilità
suitable for mass spectrometry (standard)
N° accesso UniProt
Condizioni di spedizione
ambient
Temperatura di conservazione
−20°C
Informazioni sul gene
human ... CST3(1471)
Categorie correlate
Descrizione generale
SILu™Prot CST3 is a recombinant, stable 15N isotope-labeled human CST3. Expressed in E. coli, it is designed to be used as an internal standard for bioanalysis of CST3 in mass-spectrometry. SILu™Prot CST3 is a protein of 120 amino acids, with a calculated molecular mass of 13.5 kDa.
Azioni biochim/fisiol
Cystatin C is an inhibitor of cysteine proteases including cathepsin B (which has been identified as the most important ?-amyloid-degrading enzyme. Measurement of cystatin C in serum is replacing creatinine as an indicator of kidney function (glomerular filtration rate, GFR).
Sequenza
SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Stato fisico
Supplied as a lyophilized powder containing tris buffered saline and methionine.
Note legali
This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLC
Codice della classe di stoccaggio
10 - Combustible liquids
Classe di pericolosità dell'acqua (WGK)
WGK 2
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Scegli una delle versioni più recenti:
Certificati d'analisi (COA)
Lot/Batch Number
Non trovi la versione di tuo interesse?
Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.