MSST0006
SILu™Lite VEGFA Vascular endothelial growth factor A human
recombinant, expressed in HEK 293 cells, MS Protein Standard
Sinonimo/i:
SILuLite Vascular endothelial growth factor A
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Codice UNSPSC:
23201100
NACRES:
NA.12
Prodotti consigliati
Origine biologica
human
Livello qualitativo
Ricombinante
expressed in HEK 293 cells
Saggio
≥98% (SDS-PAGE)
Forma fisica
lyophilized powder
tecniche
mass spectrometry (MS): suitable
N° accesso UniProt
Temperatura di conservazione
−20°C
Informazioni sul gene
human ... VEGFA(7422)
Categorie correlate
Descrizione generale
SILu™ Lite VEGF165 is a recombinant glycosylated human protein expressed in human 293 cells. It is a homodimer with an apparent molecular mass of 45 kDa.
Suggested Quantitative Analysis Parameters
(MRM settings provided for three suggested peptides)
Suggested Quantitative Analysis Parameters
(MRM settings provided for three suggested peptides)
Azioni biochim/fisiol
VEGF165 belongs to the PDGF/VEGF growth factor family characterized by the presence of eight conserved cysteine residues and a cystine knot structure.1 VEGF is secreted by the majority of tumor cells and initiates angiogenesis by activating endothelial cells of existing blood vessels and promoting their migration.2
VEGF has also been implicated in correlation with poor prognosis in breast cancer.2 In addition, VEGF is released in rheumatoid arthritis in response to TNF-α, increasing endothelial permeability and stimulating angiogenesis (formation of capillaries)3,4
VEGF has also been implicated in correlation with poor prognosis in breast cancer.2 In addition, VEGF is released in rheumatoid arthritis in response to TNF-α, increasing endothelial permeability and stimulating angiogenesis (formation of capillaries)3,4
Sequenza
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGC
Stato fisico
Supplied as a lyophilized powder containing phosphate buffered saline
Note legali
SILu is a trademark of Sigma-Aldrich Co. LLC
Codice della classe di stoccaggio
11 - Combustible Solids
Classe di pericolosità dell'acqua (WGK)
WGK 2
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Certificati d'analisi (COA)
Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.