HPA031531

Anti-CAPZB antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinonimo/i: Anti-CD85k, Anti-HM18, Anti-ILT3, Anti-LIR-5, Anti-capping protein (actin filament) muscle Z-line, β
• Codice UNSPSC: 12352203
• Numero Human Protein Atlas: HPA031531
• NACRES: NA.43

Proprietà

• Origine biologica: rabbit
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Nome Commerciale: Prestige Antibodies^® Powered by Atlas Antibodies
• Forma fisica: buffered aqueous glycerol solution
• Reattività contro le specie: mouse, human, rat
• tecniche: immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200
• Sequenza immunogenica: CALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPP
• N° accesso UniProt: P47756
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... CAPZB(832)

Descrizione

Descrizione generale

CAPZB (capping actin protein of muscle Z-line β subunit) gene is mapped to human chromosome 1p36.13. It is widely expressed in pharyngeal arch, and also in lymphoid cells, seminiferous ducts, urothelium and placenta. The gene codes for β-subunit of the barbed-end F-actin-binding protein.

Immunogeno

capping protein (actin filament) muscle Z-line, beta recombinant protein epitope signature tag (PrEST)

Applicazioni

All Prestige Antibodies^®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Anti-CAPZB antibody produced in rabbit has been used in immunoblotting and immunofluorescence procedures.

Azioni biochim/fisiol

CAPZB (capping actin protein of muscle Z-line βsubunit) is a heterodimeric protein that caps the growing end of F-actin. This actin-capping protein facilitates the joining of actin filaments to the Z-line of the sarcomere in muscles, thereby modulating the cytoskeleton. The protein regulates actin filament dynamics by blocking actin filament assembly and disassembly, and thereby, modulating cell shape and movement in vitro. It is known to promote cell motility by increasing the depolymerization and capping of actin filaments. CAPZB is associated with tumor progression in cases of epithelioid sarcoma.

Caratteristiche e vantaggi

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST76535

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable