HPA023881
Anti-TFE3 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Sinonimo/i:
Tfe3 Antibody, Tfe3 Antibody - Anti-TFE3 antibody produced in rabbit, TFEA, bHLHe33
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Prodotti consigliati
Origine biologica
rabbit
Coniugato
unconjugated
Forma dell’anticorpo
affinity isolated antibody
Tipo di anticorpo
primary antibodies
Clone
polyclonal
Nome Commerciale
Prestige Antibodies® Powered by Atlas Antibodies
Forma fisica
buffered aqueous glycerol solution
Reattività contro le specie
human, rat, mouse
Convalida avanzata
RNAi knockdown
Learn more about Antibody Enhanced Validation
tecniche
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000
western blot: 0.04-0.4 μg/mL
N° accesso UniProt
applicazioni
research pathology
Condizioni di spedizione
wet ice
Temperatura di conservazione
−20°C
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... TFE3(7030)
Descrizione generale
Transcription factor binding to IGHM enhancer 3 or transcription factor E3 (TFE3) gene is mapped to human chromosome Xp11.23. TFE3 belongs to helix-loop-helix leucine zipper family of transcription factors.
Immunogeno
Transcription factor binding to ighm enhancer 3 recombinant protein epitope signature tag (PrEST).
Sequence
SKDLESRQRSLEQANRSLQLRIQELELQAQIHGLPVPPTPGLLSLATTSASDSLKPEQLDIEEEGRPGAATFHVGGGPAQNAPHQQPPAPPSDALLDLHFPSDHLGDLGDPFHLGLEDILMEEEEGVVGGLSGGALSPLRAAS
Sequence
SKDLESRQRSLEQANRSLQLRIQELELQAQIHGLPVPPTPGLLSLATTSASDSLKPEQLDIEEEGRPGAATFHVGGGPAQNAPHQQPPAPPSDALLDLHFPSDHLGDLGDPFHLGLEDILMEEEEGVVGGLSGGALSPLRAAS
Applicazioni
Anti-TFE3(Transcription factor binding to IGHM enhancer 3) antibody produced in rabbit has been used:
- in immunofluorescence
- in immunocytochemistry studies
- in immunostaining
Azioni biochim/fisiol
Transcription factor binding to IGHM enhancer 3 (TFE3) interacts with other transcription factors and plays a key role in cell growth and proliferation. It promotes renal adenocarcinoma progression. TFE3 gene locus is also involved in translocations events resulting in a TFE3 fusion protein, which is a potential marker for screening their prevalence in renal cell carcinomas. It interacts and regulates expression of G-protein Gα16 and favors regulation of claudin 14.
Caratteristiche e vantaggi
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST74277
Stato fisico
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Note legali
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Non trovi il prodotto giusto?
Prova il nostro Motore di ricerca dei prodotti.
Codice della classe di stoccaggio
10 - Combustible liquids
Classe di pericolosità dell'acqua (WGK)
WGK 1
Certificati d'analisi (COA)
Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
I clienti hanno visto anche
The tumor suppressor FLCN mediates an alternate mTOR pathway to regulate browning of adipose tissue.
Shogo Wada et al.
Genes & development, 30(22), 2551-2564 (2016-12-04)
Noncanonical mechanistic target of rapamycin (mTOR) pathways remain poorly understood. Mutations in the tumor suppressor folliculin (FLCN) cause Birt-Hogg-Dubé syndrome, a hamartomatous disease marked by mitochondria-rich kidney tumors. FLCN functionally interacts with mTOR and is expressed in most tissues, but
Identification of Transcription Factor E3 (TFE3) as a Receptor-independent Activator of G alpha 16 GENE REGULATION BY NUCLEAR G alpha SUBUNIT AND ITS ACTIVATOR
Sato M, et al.
The Journal of Biological Chemistry, 286(20), 17766-17776 (2011)
ERK-independent African Green monkey pluripotent stem cells in a putative chimera-competent state
De Los Angeles A, et al.
Biochemical and Biophysical Research Communications, 510(1), 78-84 (2019)
Dun-Sheng Yang et al.
Human molecular genetics, 26(5), 843-859 (2017-01-08)
2-hydroxypropyl-β-cyclodextrin (CYCLO), a modifier of cholesterol efflux from cellular membrane and endo-lysosomal compartments, reduces lysosomal lipid accumulations and has therapeutic effects in animal models of Niemann-Pick disease type C and several other neurodegenerative states. Here, we investigated CYCLO effects on
Epithelioid hemangioendotheliomas with TFE3 gene translocations are compossible with CAMTA1 gene rearrangements
Lee SJ, et al.
Testing, 7(7), 7480-7480 (2016)
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.