AV48246

Anti-RAB11B antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-H-YPT3, Anti-MGC133246, Anti-RAB11B, member RAS oncogene family
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• PM: 24 kDa
• Reattività contro le specie: bovine, rat, mouse, goat, dog, human, guinea pig
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_004209
• N° accesso UniProt: Q15907
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... RAB11B(9230)

Descrizione

Descrizione generale

RAB11B is a GTP-binding protein that regulates diverse cellular functions.It is expressed in vesicular compartments in parietal and epithelial cells. Neuronal Rab11b has been implicated in exocytosis.
Rabbit Anti-RAB11B antibody recognizes zebrafish, human, mouse, rat, canine, chicken, and bovine RAB11B.

Immunogeno

Synthetic peptide directed towards the C terminal region of human RAB11B

Applicazioni

Rabbit Anti-RAB11B antibody is suitable for western blot applications at a concentration of 0.25 μg/ml.

Azioni biochim/fisiol

RAB11B possesses GTPase activity.

Sequenza

Synthetic peptide located within the following region: IETSALDSTNVEEAFKNILTEIYRIVSQKQIADRAAHDESPGNNVVDISV

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable