AV48007

Anti-ARRB2 antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-ARB2, Anti-ARR2, Anti-Arrestin, β 2, Anti-DKFZp686L0365
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 46 kDa
• Reattività contro le specie: human, bovine, dog, rabbit, rat, pig, horse
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunohistochemistry: suitable; western blot: suitable
• N° accesso NCBI: NP_945355
• N° accesso UniProt: P32121
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... ARRB2(409)

Descrizione

Descrizione generale

Arrestin, β 2 (ARRB2), belongs to the arrestin family and suppresses cellular responses by desensitization of G-protein coupled receptor (GPCR). It also blocks β-adrenergic-mediated functions. Genetic variations in ARRB2 have been associated with Alzheimer′s disease and tardive dyskinesia.
Rabbit Anti-ARRB2 antibody recognizes pig, rabbit, canine, chicken, mouse, human, rat, bovine, and zebrafish ARRB2.

Immunogeno

Synthetic peptide directed towards the middle region of human ARRB2

Applicazioni

Rabbit Anti-ARRB2 antibody is suitable for western blot applications at a concentration of 1μg/ml. It can also be used for IHC applications at 4-8μg/ml.

Azioni biochim/fisiol

Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. ARRB2, like arrestin beta 1, was shown to inhibit beta-adrenergic receptor function in vitro. It is expressed at high levels in the central nervous system and may play a role in the regulation of synaptic receptors. Besides the brain, a cDNA for arrestin beta 2 was isolated from thyroid gland, and thus it may also be involved in hormone-specific desensitization of TSH receptors.Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. Arrestin beta 2, like arrestin beta 1, was shown to inhibit beta-adrenergic receptor function in vitro. It is expressed at high levels in the central nervous system and may play a role in the regulation of synaptic receptors. Besides the brain, a cDNA for arrestin beta 2 was isolated from thyroid gland, and thus it may also be involved in hormone-specific desensitization of TSH receptors. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.

Sequenza

Synthetic peptide located within the following region: RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable