Passa al contenuto
Merck
Tutte le immagini(3)

Documenti fondamentali

AV46350

Sigma-Aldrich

Anti-CDT1 antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-Chromatin licensing and DNA replication factor 1, Anti-DUP, Anti-RIS2

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(3)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

60 kDa

Reattività contro le specie

human, mouse, pig, rat

Concentrazione

0.5 mg - 1 mg/mL

tecniche

immunohistochemistry: suitable
western blot: suitable

N° accesso NCBI

NP_112190

N° accesso UniProt

Q9H211

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... CDT1(81620)

Immunogeno

Synthetic peptide directed towards the C terminal region of human CDT1

Applicazioni

Anti-CDT1 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/ml.

Azioni biochim/fisiol

CDT1 (chromatin licensing and DNA replication factor 1) gene also referred to as DUP or RIS2 encodes for a protein that is a nuclear localizing replication initiation factor and is expressed only during the G1 and S phases of the cell cycle. CDT1 interacts with CDC6 and stimulates the loading of the mini-chromosome maintenance complex onto chromatin. Hence it forms a pre-replication complex necessary to initiate DNA replication. Further, geminin inhibits CDT1 and may facilitate the inhibition of replication at inappropriate origins. Overexpression of Cdt1 mRNA and geminin may play a crucial role in pathogenesis of acute leukemia (AL).

Sequenza

Synthetic peptide located within the following region: PATPPATPPAASPSALKGVSQDLLERIRAKEAQKQLAQMTRCPEQEQRLQ

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number
QC16512

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Cerca un COA

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Ke-Hua Zhang et al.
Zhongguo shi yan xue ye xue za zhi, 19(3), 578-581 (2011-07-07)
The purpose of this study was to detect the expression levels of geminin and cdt1 in peripheral blood and bone marrow from patients with newly diagnosed acute leukemia (AL), and further explore effects of them in the pathogenesis of AL.
J A Wohlschlegel et al.
Science (New York, N.Y.), 290(5500), 2309-2312 (2000-12-23)
In all eukaryotic organisms, inappropriate firing of replication origins during the G2 phase of the cell cycle is suppressed by cyclin-dependent kinases. Multicellular eukaryotes contain a second putative inhibitor of re-replication called geminin. Geminin is believed to block binding of
Jeanette Gowen Cook et al.
The Journal of biological chemistry, 279(10), 9625-9633 (2003-12-16)
Chromosomal DNA replication requires the recruitment of the six-subunit minichromosome maintenance (Mcm) complex to chromatin through the action of Cdc6 and Cdt1. Although considerable work has described the functions of Cdc6 and Cdt1 in yeast and biochemical systems, evidence that
Zannel Blanchard et al.
PloS one, 9(4), e95663-e95663 (2014-05-03)
Breast cancer is the second leading cause of cancer-related deaths in women. Triple negative breast cancer (TNBC) is an aggressive subtype that affects 10-25% mostly African American women. TNBC has the poorest prognosis of all subtypes with rapid progression leading

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.