AV41491

Anti-GPX3 antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-GPx-P, Anti-GSHPx-3, Anti-GSHPx-P, Anti-Glutathione Peroxidase 3 (plasma)
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 25 kDa
• Reattività contro le specie: mouse, rat, human, bovine
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunohistochemistry: suitable; western blot: suitable
• N° accesso NCBI: NP_002075
• N° accesso UniProt: P22352
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... GPX3(2878)

Descrizione

Descrizione generale

Glutathione peroxidase refers to a family of isozymes that protect organisms from oxidative damage by reducing lipid hydroperoxides to their corresponding alcohols. Glutathione peroxidase 3 (GPX3) is an extracellular Gpx isozyme found mainly in plasma.

Specificità

Anti-GPX3 polyclonal antibody reacts with human, mouse, rat, bovine, canine, and pig glutathione peroxidase 3 proteins.

Immunogeno

Synthetic peptide directed towards the N terminal region of human GPX3

Applicazioni

Anti-GPX3 polyclonal antibody is used to tag glutathione peroxidase-3 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to study the antioxidant lipid protecting role of glutathione peroxidase 3 in extracellular space and plasma.

Azioni biochim/fisiol

GPX3 belongs to the glutathione peroxidase family, which functions in the detoxification of hydrogen peroxide. It contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon, which normally signals translation termination.Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme. GPX3 expression appears to be tissue-specific.

Sequenza

Synthetic peptide located within the following region: DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable